ME1 anticorps

N° du produit ABIN631513

Détail du produit anti-ME1 anticorps

Antigène: ME1 (Malic Enzyme 1, NADP(+)-Dependent, Cytosolic (ME1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ME1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: ME1 antibody was raised using a synthetic peptide corresponding to a region with amino acids QQLNIHGLLPPSFNSQEIQVLRVVKNFEHLNSDFDRYLLLMDLQDRNEKL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ME1 Blocking Peptide, catalog no. 33R-7695, is also available for use as a blocking control in assays to test for specificity of this ME1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ME1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ME1

Antigène: ME1 (Malic Enzyme 1, NADP(+)-Dependent, Cytosolic (ME1))

Autre désignation: ME1 (ME1 Produits)

Synonymes: anticorps HUMNDME, anticorps MES, anticorps D9Ertd267e, anticorps Mdh-1, anticorps Mod-1, anticorps Mod1, anticorps MOD1, anticorps ME1, anticorps zgc:153079, anticorps malic enzyme 1, anticorps malic enzyme 1, NADP(+)-dependent, cytosolic, anticorps ME1, anticorps Me1, anticorps me1

Sujet: ME1 is a cytosolic, NADP-dependent enzyme that generates NADPH for fatty acid biosynthesis. The activity of this enzyme, the reversible oxidative decarboxylation of malate, links the glycolytic and citric acid cycles. The regulation of expression for this gene is complex. Increased expression can result from elevated levels of thyroid hormones or by higher proportions of carbohydrates in the diet.

Poids moléculaire: 64 kDa (MW of target protein)

Pathways: Regulation of Lipid Metabolism by PPARalpha