ATP6V1A anticorps (N-Term)

N° du produit ABIN631586

Détail du produit anti-ATP6V1A anticorps

Antigène: ATP6V1A (ATPase, H+ Transporting, Lysosomal 70kDa, V1 Subunit A (ATP6V1A))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ATP6V1A est non-conjugé

Application: Western Blotting (WB)

Specificité: ATP6 V6 antibody was raised against the N terminal of ATP6 6

Purification: Affinity purified

Immunogène: ATP6 V6 antibody was raised using the N terminal of ATP6 6 corresponding to a region with amino acids SGVSVGDPVLRTGKPLSVELGPGIMGAIFDGIQRPLSDISSQTQSIYIPR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ATP6V1A Blocking Peptide, catalog no. 33R-8503, is also available for use as a blocking control in assays to test for specificity of this ATP6V1A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ATP6V1A

Antigène: ATP6V1A (ATPase, H+ Transporting, Lysosomal 70kDa, V1 Subunit A (ATP6V1A))

Autre désignation: ATP6V1A (ATP6V1A Produits)

Synonymes: anticorps ATP6A1, anticorps ATP6V1A1, anticorps HO68, anticorps VA68, anticorps VPP2, anticorps Vma1, anticorps AI647066, anticorps Atp6a1, anticorps Atp6a2, anticorps Atp6v1a1, anticorps ATP6V1A, anticorps atp6v1al, anticorps zgc:63516, anticorps An02g10440, anticorps AO090102000349, anticorps vacuolar ATP synthase subunit A, anticorps atp6a1, anticorps atp6v1a1, anticorps ho68, anticorps v1a, anticorps va68, anticorps vma1, anticorps vpp2, anticorps CG12403, anticorps Dmel\CG12403, anticorps V-ATPase, anticorps Vha, anticorps Vha-68-1, anticorps Vha68, anticorps vha67-2, anticorps vha68-1, anticorps ATPase H+ transporting V1 subunit A, anticorps ATPase, H+ transporting, lysosomal V1 subunit A, anticorps ATPase, H+ transporting, lysosomal, V1 subunit Aa, anticorps v-type proton ATPase catalytic subunit A, anticorps vacuolar ATP synthase subunit A, anticorps ATPase H+ transporting V1 subunit A L homeolog, anticorps vacuolar proton pump 3, anticorps Vacuolar H[+] ATPase 68kD subunit 1, anticorps ATP6V1A, anticorps Atp6v1a, anticorps atp6v1aa, anticorps ANI_1_1468024, anticorps AOR_1_602134, anticorps VHA-A, anticorps atp6v1a.L, anticorps vpp3, anticorps Vha68-1

Sujet: This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles.

Poids moléculaire: 68 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis, Proton Transport, SARS-CoV-2 Protein Interactome