ARPC3 anticorps (Middle Region)
-
- Antigène Voir toutes ARPC3 Anticorps
- ARPC3 (Actin Related Protein 2/3 Complex, Subunit 3, 21kDa (ARPC3))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ARPC3 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ARPC3 antibody was raised against the middle region of ARPC3
- Purification
- Affinity purified
- Immunogène
- ARPC3 antibody was raised using the middle region of ARPC3 corresponding to a region with amino acids ITLYISECLKKLQKCNSKSQGEKEMYTLGITNFPIPGEPGFPLNAIYAKP
- Top Product
- Discover our top product ARPC3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ARPC3 Blocking Peptide, catalog no. 33R-4181, is also available for use as a blocking control in assays to test for specificity of this ARPC3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARPC3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ARPC3 (Actin Related Protein 2/3 Complex, Subunit 3, 21kDa (ARPC3))
- Autre désignation
- ARPC3 (ARPC3 Produits)
- Synonymes
- anticorps ARC21, anticorps p21-Arc, anticorps 1110006A04Rik, anticorps 21kDa, anticorps AA408672, anticorps AI788639, anticorps p21-Ar, anticorps p21Arc, anticorps arc21, anticorps p21-arc, anticorps zgc:86828, anticorps actin related protein 2/3 complex subunit 3, anticorps actin related protein 2/3 complex, subunit 3, anticorps actin related protein 2/3 complex subunit 3 L homeolog, anticorps actin related protein 2/3 complex, subunit 3, 21kDa, anticorps actin related protein 2/3 complex subunit 3 pseudogene, anticorps actin-related protein 2/3 complex subunit 3, anticorps actin-related protein 2/3 complex subunit 3 pseudogene, anticorps ARPC3, anticorps Arpc3, anticorps arpc3.L, anticorps LOC738738, anticorps arpc3, anticorps LOC100036831, anticorps LOC100341254
- Sujet
- ARPC3 is one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of the protein, the p21 subunit, has yet to be determined.
- Poids moléculaire
- 20 kDa (MW of target protein)
- Pathways
- Signalisation RTK, Regulation of Actin Filament Polymerization
-