NEDD4 anticorps (Middle Region)
-
- Antigène Voir toutes NEDD4 Anticorps
- NEDD4 (Neural Precursor Cell Expressed, Developmentally Down-Regulated 4, E3 Ubiquitin Protein Ligase (NEDD4))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp NEDD4 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- NEDD4 antibody was raised against the middle region of NEDD4
- Purification
- Affinity purified
- Immunogène
- NEDD4 antibody was raised using the middle region of NEDD4 corresponding to a region with amino acids SRRGSLQAYTFEEQPTLPVLLPTSSGLPPGWEEKQDERGRSYYVDHNSRT
- Top Product
- Discover our top product NEDD4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
NEDD4 Blocking Peptide, catalog no. 33R-8771, is also available for use as a blocking control in assays to test for specificity of this NEDD4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NEDD4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- NEDD4 (Neural Precursor Cell Expressed, Developmentally Down-Regulated 4, E3 Ubiquitin Protein Ligase (NEDD4))
- Autre désignation
- NEDD4 (NEDD4 Produits)
- Synonymes
- anticorps NEDD4-1, anticorps RPF1, anticorps AA959633, anticorps AL023035, anticorps AU019897, anticorps E430025J12Rik, anticorps Nedd4-1, anticorps Nedd4a, anticorps mKIAA0093, anticorps CG32184, anticorps CG42279, anticorps CG7555, anticorps DNedd4, anticorps Dmel\\CG42279, anticorps Dmel_CG32184, anticorps Dmel_CG7555, anticorps dNedd4, anticorps dNedd4-1, anticorps nedd4, anticorps GB16853, anticorps NEDD4, anticorps Nedd4, anticorps neural precursor cell expressed, developmentally down-regulated 4, E3 ubiquitin protein ligase, anticorps neural precursor cell expressed, developmentally down-regulated 4, anticorps CG42279 gene product from transcript CG42279-RJ, anticorps E3 ubiquitin-protein ligase Nedd-4, anticorps E3 ubiquitin-protein ligase NEDD4, anticorps NEDD4, anticorps Nedd4, anticorps LOC411723, anticorps LOC100457150, anticorps nedd4, anticorps LOC100547485
- Sujet
- NEDD4 is an E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfers the ubiquitin to targeted substrates. NEDD4 is involved in the budding of many viruses.
- Poids moléculaire
- 104 kDa (MW of target protein)
- Pathways
- Signalisation Notch, Intracellular Steroid Hormone Receptor Signaling Pathway, Skeletal Muscle Fiber Development, Signaling Events mediated by VEGFR1 and VEGFR2
-