FBXW8 anticorps (Middle Region)
-
- Antigène Voir toutes FBXW8 Anticorps
- FBXW8 (F-Box and WD Repeat Domain Containing 8 (FBXW8))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp FBXW8 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- FBXW8 antibody was raised against the middle region of FBXW8
- Purification
- Affinity purified
- Immunogène
- FBXW8 antibody was raised using the middle region of FBXW8 corresponding to a region with amino acids MNQKLWEVYSGHPVQHISFSSHSLITANVPYQTVMRNADLDSFTTHRRHR
- Top Product
- Discover our top product FBXW8 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
FBXW8 Blocking Peptide, catalog no. 33R-6260, is also available for use as a blocking control in assays to test for specificity of this FBXW8 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXW8 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- FBXW8 (F-Box and WD Repeat Domain Containing 8 (FBXW8))
- Autre désignation
- FBXW8 (FBXW8 Produits)
- Synonymes
- anticorps FBW6, anticorps FBW8, anticorps FBX29, anticorps FBXO29, anticorps FBXW6, anticorps 4930438M06Rik, anticorps Fbx29, anticorps F-box and WD repeat domain containing 8, anticorps ring finger protein, transmembrane 2, anticorps F-box and WD-40 domain protein 8, anticorps FBXW8, anticorps Fbxw8, anticorps RNFT2
- Sujet
- FBXW8 is a member of the F-box protein family, members of which are characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into three classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. FBXW8 contains a WD-40 domain, in addition to an F-box motif, so it belongs to the Fbw class.
- Poids moléculaire
- 67 kDa (MW of target protein)
-