SPAG6 anticorps (Middle Region)

N° du produit ABIN631997

Détail du produit anti-SPAG6 anticorps

Antigène: SPAG6 (Sperm Associated Antigen 6 (SPAG6))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SPAG6 est non-conjugé

Application: Western Blotting (WB)

Specificité: SPAG6 antibody was raised against the middle region of SPAG6

Purification: Affinity purified

Immunogène: SPAG6 antibody was raised using the middle region of SPAG6 corresponding to a region with amino acids HVVGQFSKVLPHDSKARRLFVTSGGLKKVQEIKAEPGSLLQEYINSINSC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SPAG6 Blocking Peptide, catalog no. 33R-3872, is also available for use as a blocking control in assays to test for specificity of this SPAG6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPAG6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SPAG6

Antigène: SPAG6 (Sperm Associated Antigen 6 (SPAG6))

Autre désignation: SPAG6 (SPAG6 Produits)

Synonymes: anticorps Repro-SA-1, anticorps pf16, anticorps PF16, anticorps RGD1310892, anticorps zgc:91805, anticorps SPAG6, anticorps repro-sa-1, anticorps DKFZp459D035, anticorps sperm associated antigen 6, anticorps sperm associated antigen 6-like, anticorps sperm associated antigen 6 L homeolog, anticorps SPAG6, anticorps Spag6l, anticorps Spag6, anticorps spag6, anticorps spag6.L

Sujet: SPAG6 is important for structural integrity of the central apparatus in the sperm tail and for flagellar motility.

Poids moléculaire: 56 kDa (MW of target protein)