SPAG6 anticorps (Middle Region)
-
- Antigène Voir toutes SPAG6 Anticorps
- SPAG6 (Sperm Associated Antigen 6 (SPAG6))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SPAG6 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SPAG6 antibody was raised against the middle region of SPAG6
- Purification
- Affinity purified
- Immunogène
- SPAG6 antibody was raised using the middle region of SPAG6 corresponding to a region with amino acids HVVGQFSKVLPHDSKARRLFVTSGGLKKVQEIKAEPGSLLQEYINSINSC
- Top Product
- Discover our top product SPAG6 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SPAG6 Blocking Peptide, catalog no. 33R-3872, is also available for use as a blocking control in assays to test for specificity of this SPAG6 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPAG6 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SPAG6 (Sperm Associated Antigen 6 (SPAG6))
- Autre désignation
- SPAG6 (SPAG6 Produits)
- Synonymes
- anticorps Repro-SA-1, anticorps pf16, anticorps PF16, anticorps RGD1310892, anticorps zgc:91805, anticorps SPAG6, anticorps repro-sa-1, anticorps DKFZp459D035, anticorps sperm associated antigen 6, anticorps sperm associated antigen 6-like, anticorps sperm associated antigen 6 L homeolog, anticorps SPAG6, anticorps Spag6l, anticorps Spag6, anticorps spag6, anticorps spag6.L
- Sujet
- SPAG6 is important for structural integrity of the central apparatus in the sperm tail and for flagellar motility.
- Poids moléculaire
- 56 kDa (MW of target protein)
-