Calpain S1 anticorps (Middle Region)

N° du produit ABIN632073

Détail du produit anti-Calpain S1 anticorps

Antigène: Calpain S1 (CAPNS1) (Calpain, Small Subunit 1 (CAPNS1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Calpain S1 est non-conjugé

Application: Western Blotting (WB)

Specificité: Calpain 4 antibody was raised against the middle region of CAPNS1

Purification: Affinity purified

Immunogène: Calpain 4 antibody was raised using the middle region of CAPNS1 corresponding to a region with amino acids RRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Calpain 4 Blocking Peptide, catalog no. 33R-8169, is also available for use as a blocking control in assays to test for specificity of this Calpain 4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CAPNS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Calpain S1

Antigène: Calpain S1 (CAPNS1) (Calpain, Small Subunit 1 (CAPNS1))

Autre désignation: Calpain 4 (CAPNS1 Produits)

Synonymes: anticorps 30K, anticorps CALPAIN4, anticorps CANP, anticorps CANPS, anticorps CAPN4, anticorps CDPS, anticorps CSS1, anticorps Capn4, anticorps CAPNS1, anticorps Capa-4, anticorps Capa4, anticorps D7Ertd146e, anticorps MGC84330, anticorps capns1, anticorps cb616, anticorps wu:fb81g08, anticorps wu:fl09e04, anticorps zgc:110603, anticorps calpain small subunit 1, anticorps calpain, small subunit 1, anticorps calpain, small subunit 1 L homeolog, anticorps calpain, small subunit 1 a, anticorps CAPNS1, anticorps Capns1, anticorps capns1.L, anticorps capns1a

Sujet: Calpains are a ubiquitous, well-conserved family of calcium-dependent, cysteine proteases. Calpain families have been implicated in neurodegenerative processes, as their activation can be triggered by calcium influx and oxidative stress. Calpain I and II are heterodimeric with distinct large subunits associated with common small subunits, all of which are encoded by different genes.

Poids moléculaire: 29 kDa (MW of target protein)

Pathways: Apoptose