Calpain S1 anticorps (Middle Region)

N° du produit ABIN632073

Cet anticorps anti-Calpain S1 Polyclonal Lapin (ABIN632073) détecte spécifiquement Calpain S1 dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour Calpain S1 anticorps (Middle Region) (ABIN632073)

Antigène: Calpain S1 (CAPNS1) (Calpain, Small Subunit 1 (CAPNS1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Calpain S1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Calpain S1 anticorps

Épitope: Middle Region

Specificité: Calpain 4 antibody was raised against the middle region of CAPNS1

Purification: Affinity purified

Immunogène: Calpain 4 antibody was raised using the middle region of CAPNS1 corresponding to a region with amino acids RRYSDESGNMDFDNFISCLVRLDAMFRAFKSLDKDGTGQIQVNIQEWLQL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Calpain 4 Blocking Peptide, (ABIN5612585), is also available for use as a blocking control in assays to test for specificity of this Calpain 4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CAPNS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Calpain S1

Antigène: Calpain S1 (CAPNS1) (Calpain, Small Subunit 1 (CAPNS1))

Autre désignation: Calpain 4

Sujet: Calpains are a ubiquitous, well-conserved family of calcium-dependent, cysteine proteases. Calpain families have been implicated in neurodegenerative processes, as their activation can be triggered by calcium influx and oxidative stress. Calpain I and II are heterodimeric with distinct large subunits associated with common small subunits, all of which are encoded by different genes.

Poids moléculaire: 29 kDa (MW of target protein)

Pathways: Apoptose