CSK anticorps (Middle Region)

N° du produit ABIN632232

Détail du produit anti-CSK anticorps

Antigène: CSK (C-Src tyrosine Kinase (CSK))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CSK est non-conjugé

Application: Western Blotting (WB)

Specificité: CSK antibody was raised against the middle region of CSK

Purification: Affinity purified

Immunogène: CSK antibody was raised using the middle region of CSK corresponding to a region with amino acids SEDNVAKVSDFGLTKEASSTQDTGKLPVKWTAPEALREKKFSTKSDVWSF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CSK Blocking Peptide, catalog no. 33R-8387, is also available for use as a blocking control in assays to test for specificity of this CSK antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CSK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CSK

Antigène: CSK (C-Src tyrosine Kinase (CSK))

Autre désignation: CSK (CSK Produits)

Synonymes: anticorps AW212630, anticorps C-terminal Src kinase, anticorps c-src tyrosine kinase, anticorps CSK, non-receptor tyrosine kinase, anticorps CSK, anticorps Csk

Sujet: CSK specifically phosphorylates 'Tyr-504' on LCK, which acts as a negative regulatory site.

Poids moléculaire: 51 kDa (MW of target protein)

Pathways: TCR Signaling, EGFR Signaling Pathway, Cell-Cell Junction Organization, CXCR4-mediated Signaling Events