PRKAB2 anticorps (Middle Region)
-
- Antigène Voir toutes PRKAB2 Anticorps
- PRKAB2 (Protein Kinase, AMP-Activated, beta 2 Non-Catalytic Subunit (PRKAB2))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PRKAB2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PRKAB2 antibody was raised against the middle region of PRKAB2
- Purification
- Affinity purified
- Immunogène
- PRKAB2 antibody was raised using the middle region of PRKAB2 corresponding to a region with amino acids RDLSSSPPGPYGQEMYAFRSEERFKSPPILPPHLLQVILNKDTNISCDPA
- Top Product
- Discover our top product PRKAB2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PRKAB2 Blocking Peptide, catalog no. 33R-7854, is also available for use as a blocking control in assays to test for specificity of this PRKAB2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKAB2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PRKAB2 (Protein Kinase, AMP-Activated, beta 2 Non-Catalytic Subunit (PRKAB2))
- Autre désignation
- PRKAB2 (PRKAB2 Produits)
- Synonymes
- anticorps prkab2, anticorps MGC64365, anticorps PRKAB2, anticorps DKFZp469M1118, anticorps 5730553K21Rik, anticorps AW049591, anticorps BB124140, anticorps protein kinase, AMP-activated, beta 2 non-catalytic subunit L homeolog, anticorps protein kinase AMP-activated non-catalytic subunit beta 2, anticorps protein kinase, AMP-activated, beta 2 non-catalytic subunit, anticorps prkab2.L, anticorps PRKAB2, anticorps prkab2, anticorps Prkab2
- Sujet
- The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits.
- Poids moléculaire
- 30 kDa (MW of target protein)
- Pathways
- AMPK Signaling, L'effet Warburg
-