PRKAB2 anticorps (Middle Region)

N° du produit ABIN632267

Détail du produit anti-PRKAB2 anticorps

Antigène: PRKAB2 (Protein Kinase, AMP-Activated, beta 2 Non-Catalytic Subunit (PRKAB2))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PRKAB2 est non-conjugé

Application: Western Blotting (WB)

Specificité: PRKAB2 antibody was raised against the middle region of PRKAB2

Purification: Affinity purified

Immunogène: PRKAB2 antibody was raised using the middle region of PRKAB2 corresponding to a region with amino acids RDLSSSPPGPYGQEMYAFRSEERFKSPPILPPHLLQVILNKDTNISCDPA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PRKAB2 Blocking Peptide, catalog no. 33R-7854, is also available for use as a blocking control in assays to test for specificity of this PRKAB2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKAB2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PRKAB2

Antigène: PRKAB2 (Protein Kinase, AMP-Activated, beta 2 Non-Catalytic Subunit (PRKAB2))

Autre désignation: PRKAB2 (PRKAB2 Produits)

Synonymes: anticorps prkab2, anticorps MGC64365, anticorps PRKAB2, anticorps DKFZp469M1118, anticorps 5730553K21Rik, anticorps AW049591, anticorps BB124140, anticorps protein kinase, AMP-activated, beta 2 non-catalytic subunit L homeolog, anticorps protein kinase AMP-activated non-catalytic subunit beta 2, anticorps protein kinase, AMP-activated, beta 2 non-catalytic subunit, anticorps prkab2.L, anticorps PRKAB2, anticorps prkab2, anticorps Prkab2

Sujet: The protein encoded by this gene is a regulatory subunit of the AMP-activated protein kinase (AMPK). AMPK is a heterotrimer consisting of an alpha catalytic subunit, and non-catalytic beta and gamma subunits.

Poids moléculaire: 30 kDa (MW of target protein)

Pathways: AMPK Signaling, L'effet Warburg