RPRD1B anticorps (Middle Region)

N° du produit ABIN632445

Détail du produit anti-RPRD1B anticorps

Antigène: RPRD1B (Regulation of Nuclear Pre-mRNA Domain Containing 1B (RPRD1B))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RPRD1B est non-conjugé

Application: Western Blotting (WB)

Specificité: RPRD1 B antibody was raised against the middle region of RPRD1

Purification: Affinity purified

Immunogène: RPRD1 B antibody was raised using the middle region of RPRD1 corresponding to a region with amino acids KKSLKRTFQQIQEEEDDDYPGSYSPQDPSAGPLLTEELIKALQDLENAAS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RPRD1B Blocking Peptide, catalog no. 33R-4494, is also available for use as a blocking control in assays to test for specificity of this RPRD1B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPRD0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RPRD1B

Antigène: RPRD1B (Regulation of Nuclear Pre-mRNA Domain Containing 1B (RPRD1B))

Autre désignation: RPRD1B (RPRD1B Produits)

Synonymes: anticorps fb23h08, anticorps zgc:55687, anticorps wu:fb23h08, anticorps rprd1ba, anticorps MGC130705, anticorps C13H20ORF77, anticorps C20orf77, anticorps CREPT, anticorps NET60, anticorps dJ1057B20.2, anticorps 2610304G08Rik, anticorps 2810446G03Rik, anticorps Crept, anticorps RGD1304782, anticorps regulation of nuclear pre-mRNA domain containing 1B, anticorps regulation of nuclear pre-mRNA domain containing 1B L homeolog, anticorps rprd1b, anticorps rprd1b.L, anticorps RPRD1B, anticorps Rprd1b

Sujet: The function of RPRD1B protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 37 kDa (MW of target protein)