CTDSP2 anticorps
-
- Antigène Voir toutes CTDSP2 Anticorps
- CTDSP2 (CTD (Carboxy-terminal Domain, RNA Polymerase II, Polypeptide A) Small Phosphatase 2 (CTDSP2))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp CTDSP2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- CTDSP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids MEHGSIITQARREDALVLTKQGLVSKSSPKKPRGRNIFKALFCCFRAQHV
- Top Product
- Discover our top product CTDSP2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
CTDSP2 Blocking Peptide, catalog no. 33R-5924, is also available for use as a blocking control in assays to test for specificity of this CTDSP2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CTDSP2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- CTDSP2 (CTD (Carboxy-terminal Domain, RNA Polymerase II, Polypeptide A) Small Phosphatase 2 (CTDSP2))
- Autre désignation
- CTDSP2 (CTDSP2 Produits)
- Synonymes
- anticorps fb16c04, anticorps wu:fb16c04, anticorps zgc:77714, anticorps MGC68415, anticorps CTDSP2, anticorps OS4, anticorps PSR2, anticorps SCP2, anticorps AI586070, anticorps D10Ertd73e, anticorps OS-4, anticorps CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) small phosphatase 2, anticorps CTD small phosphatase 2 L homeolog, anticorps CTD small phosphatase 2, anticorps ctdsp2, anticorps ctdsp2.L, anticorps CTDSP2, anticorps Ctdsp2
- Sujet
- CTDSP2 preferentially catalyzes the dephosphorylation of 'Ser-5' within the tandem 7 residues repeats in the C-terminal domain (CTD) of the largest RNA polymerase II subunit POLR2A.
- Poids moléculaire
- 31 kDa (MW of target protein)
- Pathways
- ER-Nucleus Signaling
-