ACLY anticorps (Middle Region)

N° du produit ABIN632477

Détail du produit anti-ACLY anticorps

Antigène: ACLY (ATP Citrate Lyase (ACLY))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ACLY est non-conjugé

Application: Western Blotting (WB)

Specificité: ACLY antibody was raised against the middle region of ACLY

Purification: Affinity purified

Immunogène: ACLY antibody was raised using the middle region of ACLY corresponding to a region with amino acids LRSAYDSTMETMNYAQIRTIAIIAEGIPEALTRKLIKKADQKGVTIIGPA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ACLY Blocking Peptide, catalog no. 33R-5389, is also available for use as a blocking control in assays to test for specificity of this ACLY antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACLY antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ACLY

Antigène: ACLY (ATP Citrate Lyase (ACLY))

Autre désignation: ACLY (ACLY Produits)

Synonymes: anticorps ACLY, anticorps DDBDRAFT_0205389, anticorps DDBDRAFT_0235360, anticorps DDB_0205389, anticorps DDB_0235360, anticorps ACL, anticorps BcDNA:LD21334, anticorps CG8322, anticorps DmATPCL, anticorps Dmel\\CG8322, anticorps anon-WO0140519.179, anticorps dATPCL, anticorps l(2)01466, anticorps l(2)k09217, anticorps n(2)k09217, anticorps ATPCL, anticorps CLATP, anticorps A730098H14Rik, anticorps AW538652, anticorps Clatp, anticorps acly, anticorps cb722, anticorps zgc:92008, anticorps ATP citrate lyase, anticorps ATP citrate lyase S homeolog, anticorps ATP-citrate synthase, anticorps citrate synthase, mitochondrial, anticorps atp-citrate synthase, anticorps ATP citrate lyase a, anticorps ACLY, anticorps acly.S, anticorps LOC587157, anticorps acly, anticorps ATPCL, anticorps LOC5564509, anticorps CpipJ_CPIJ010291, anticorps Bm1_26245, anticorps ACL, anticorps Acly, anticorps aclya

Sujet: ATP citrate lyase is the primary enzyme responsible for the synthesis of cytosolic acetyl-CoA in many tissues. The enzyme is a tetramer (relative molecular weight approximately 440,000) of apparently identical subunits.

Poids moléculaire: 121 kDa (MW of target protein)

Pathways: L'effet Warburg