RAP1 anticorps (Middle Region)

N° du produit ABIN632636

Détail du produit anti-RAP1 anticorps

Antigène: RAP1 (TERF2IP) (Telomeric Repeat Binding Factor 2, Interacting Protein (TERF2IP))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RAP1 est non-conjugé

Application: Western Blotting (WB)

Specificité: TERF2 IP antibody was raised against the middle region of TERF2 P

Purification: Affinity purified

Immunogène: TERF2 IP antibody was raised using the middle region of TERF2 P corresponding to a region with amino acids EDPEAADSGEPQNKRTPDLPEEEYVKEEIQENEEAVKKMLVEATREFEEV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TERF2IP Blocking Peptide, catalog no. 33R-2322, is also available for use as a blocking control in assays to test for specificity of this TERF2IP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TERF0 P antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RAP1

Antigène: RAP1 (TERF2IP) (Telomeric Repeat Binding Factor 2, Interacting Protein (TERF2IP))

Autre désignation: TERF2IP (TERF2IP Produits)

Synonymes: anticorps DRIP5, anticorps RAP1, anticorps Rap1, anticorps cRAP1, anticorps TERF2 interacting protein, anticorps telomeric repeat binding factor 2, interacting protein, anticorps TERF2IP, anticorps Terf2ip

Sujet: The gene encodes a protein that is part of a complex involved in telomere length regulation. Pseudogenes are present on chromosomes 5 and 22.

Poids moléculaire: 44 kDa (MW of target protein)

Pathways: Cycle Cellulaire, Telomere Maintenance