SLU7 anticorps
-
- Antigène Voir toutes SLU7 Anticorps
- SLU7 (SLU7 Splicing Factor Homolog (SLU7))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SLU7 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- SLU7 antibody was raised using a synthetic peptide corresponding to a region with amino acids KKKELEEQRKLGNAPAEVDEEGKDINPHIPQYISSVPWYIDPSKRPTLKH
- Top Product
- Discover our top product SLU7 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SLU7 Blocking Peptide, catalog no. 33R-4475, is also available for use as a blocking control in assays to test for specificity of this SLU7 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLU7 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SLU7 (SLU7 Splicing Factor Homolog (SLU7))
- Autre désignation
- SLU7 (SLU7 Produits)
- Synonymes
- anticorps 9G8, anticorps hSlu7, anticorps AU018913, anticorps D11Ertd730e, anticorps D3Bwg0878e, anticorps 9g8, anticorps hslu7, anticorps wu:fc94e11, anticorps zgc:103640, anticorps CG1420, anticorps Dmel\\CG1420, anticorps SLU7, anticorps SLU7 homolog, splicing factor, anticorps SLU7 splicing factor homolog (S. cerevisiae), anticorps SLU7 homolog, splicing factor L homeolog, anticorps CG1420 gene product from transcript CG1420-RA, anticorps SLU7, anticorps Slu7, anticorps slu7.L, anticorps slu7
- Classe de substances
- Influenza Protein
- Sujet
- Pre-mRNA splicing occurs in two sequential transesterification steps. The protein encoded by this gene is a splicing factor that has been found to be essential during the second catalytic step in the pre-mRNA splicing process.
- Poids moléculaire
- 68 kDa (MW of target protein)
- Pathways
- Ribonucleoprotein Complex Subunit Organization, SARS-CoV-2 Protein Interactome
-