OTUB1 anticorps (Middle Region)
-
- Antigène Voir toutes OTUB1 Anticorps
- OTUB1 (OTU Domain, Ubiquitin Aldehyde Binding 1 (OTUB1))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp OTUB1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- OTUB1 antibody was raised against the middle region of OTUB1
- Purification
- Affinity purified
- Immunogène
- OTUB1 antibody was raised using the middle region of OTUB1 corresponding to a region with amino acids KIKDLHKKYSYIRKTRPDGNCFYRAFGFSHLEALLDDSKELQRFKAVSAK
- Top Product
- Discover our top product OTUB1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
OTUB1 Blocking Peptide, catalog no. 33R-4432, is also available for use as a blocking control in assays to test for specificity of this OTUB1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OTUB1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- OTUB1 (OTU Domain, Ubiquitin Aldehyde Binding 1 (OTUB1))
- Autre désignation
- OTUB1 (OTUB1 Produits)
- Synonymes
- anticorps OTB1, anticorps OTU1, anticorps AI850305, anticorps fa19h07, anticorps otub1, anticorps wu:fa19h07, anticorps zgc:92839, anticorps MGC131231, anticorps fb17f04, anticorps otub1l, anticorps wu:fb17f04, anticorps zgc:92685, anticorps OTU deubiquitinase, ubiquitin aldehyde binding 1, anticorps OTU domain, ubiquitin aldehyde binding 1, anticorps OTU deubiquitinase, ubiquitin aldehyde binding 1b, anticorps OTU deubiquitinase, ubiquitin aldehyde binding 1 L homeolog, anticorps similar to HSPC263, anticorps OTU deubiquitinase, ubiquitin aldehyde binding 1a, anticorps OTUB1, anticorps Otub1, anticorps otub1b, anticorps otub1.L, anticorps otub1, anticorps RGD1565010, anticorps otub1a
- Sujet
- The product of this gene is a member of the OTU (ovarian tumor) superfamily of predicted cysteine proteases. The encoded protein is a highly specific ubiquitin iso-peptidase, and cleaves ubiquitin from branched poly-ubiquitin chains but not from ubiquitin.
- Poids moléculaire
- 31 kDa (MW of target protein)
-