FZR1 anticorps

N° du produit ABIN633045

Détail du produit anti-FZR1 anticorps

Antigène: FZR1 (Fizzy/cell Division Cycle 20 Related 1 (FZR1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FZR1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: FZR1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SSPVSSPSKHGDRFIPSRAGANWSVNFHRINENEKSPSQNRKAKDATSDN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FZR1 Blocking Peptide, catalog no. 33R-8839, is also available for use as a blocking control in assays to test for specificity of this FZR1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FZR1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FZR1

Antigène: FZR1 (Fizzy/cell Division Cycle 20 Related 1 (FZR1))

Autre désignation: FZR1 (FZR1 Produits)

Synonymes: anticorps CDH1-C, anticorps FYR, anticorps FZR, anticorps CDH1, anticorps fzr1, anticorps CDC20C, anticorps FZR2, anticorps HCDH, anticorps HCDH1, anticorps AW108046, anticorps Cdh1, anticorps Fyr, anticorps zgc:55450, anticorps fizzy and cell division cycle 20 related 1, anticorps fizzy/cell division cycle 20 related 1, anticorps fizzy-related protein homolog, anticorps fizzy/cell division cycle 20 related 1 (Drosophila), anticorps fizzy/cell division cycle 20 related 1a, anticorps Fzr1, anticorps CDH1-C, anticorps FZR1, anticorps LOC100027495, anticorps LOC100179951, anticorps fzr1a

Sujet: FZR1 is a key regulator of ligase activity of the anaphase promoting complex/cyclosome (APC/C), which confers substrate specificity upon the complex. FZR1 associates with the APC/C in late mitosis, in replacement of CDC20, and activates the APC/C during anaphase and telophase. The APC/C remains active in degrading substrates to ensure that positive regulators of the cell cycle do not accumulate prematurely. At the G1/S transition FZR1 is phosphorylated, leading to its dissociation from the APC/C. Following DNA damage, it is required for the G2 DNA damage checkpoint: its dephosphorylation and reassociation with the APC/C leads to the ubiquitination of PLK1, preventing entry into mitosis.

Poids moléculaire: 55 kDa (MW of target protein)

Pathways: DNA Replication, Synthesis of DNA