HLA-DQA2 anticorps (N-Term)

N° du produit ABIN633061

Détail du produit anti-HLA-DQA2 anticorps

Antigène: HLA-DQA2 (Major Histocompatibility Complex, Class II, DQ alpha 2 (HLA-DQA2))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HLA-DQA2 est non-conjugé

Application: Western Blotting (WB)

Specificité: HLA-DQA2 antibody was raised against the N terminal of HLA-DQA2

Purification: Affinity purified

Immunogène: HLA-DQA2 antibody was raised using the N terminal of HLA-DQA2 corresponding to a region with amino acids GVNFYQSHGPSGQYTHEFDGDEEFYVDLETKETVWQLPMFSKFISFDPQS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HLA-DQA2 Blocking Peptide, catalog no. 33R-3648, is also available for use as a blocking control in assays to test for specificity of this HLA-DQA2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HLA-DQA2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HLA-DQA2

Antigène: HLA-DQA2 (Major Histocompatibility Complex, Class II, DQ alpha 2 (HLA-DQA2))

Autre désignation: HLA-DQA2 (HLA-DQA2 Produits)

Synonymes: anticorps DX-ALPHA, anticorps HLA-DXA, anticorps major histocompatibility complex, class II, DQ alpha 2, anticorps HLA-DQA2

Sujet: This gene belongs to the HLA class II alpha chain family. The encoded protein forms a heterodimer with a class II beta chain. It is located in intracellular vesicles and plays a central role in the peptide loading of MHC class II molecules by helping to release the CLIP molecule from the peptide binding site. Class II molecules are expressed in antigen presenting cells (B lymphocytes, dendritic cells, macrophages) and are used to present antigenic peptides on the cell surface to be recognised by CD4 T-cells.

Poids moléculaire: 28 kDa (MW of target protein)

Pathways: TCR Signaling