ATP6AP1 anticorps (Middle Region)

N° du produit ABIN633093

Détail du produit anti-ATP6AP1 anticorps

Antigène: ATP6AP1 (ATPase, H+ Transporting, Lysosomal Accessory Protein 1 (ATP6AP1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ATP6AP1 est non-conjugé

Application: Western Blotting (WB)

Specificité: ATP6 AP1 antibody was raised against the middle region of ATP6 P1

Purification: Affinity purified

Immunogène: ATP6 AP1 antibody was raised using the middle region of ATP6 P1 corresponding to a region with amino acids SPVIHPPVSYNDTAPRILFWAQNFSVAYKDQWEDLTPLTFGVQELNLTGS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ATP6AP1 Blocking Peptide, catalog no. 33R-8700, is also available for use as a blocking control in assays to test for specificity of this ATP6AP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATP0 P1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ATP6AP1

Antigène: ATP6AP1 (ATPase, H+ Transporting, Lysosomal Accessory Protein 1 (ATP6AP1))

Autre désignation: ATP6AP1 (ATP6AP1 Produits)

Synonymes: anticorps 16A, anticorps ATP6IP1, anticorps ATP6S1, anticorps Ac45, anticorps CF2, anticorps VATPS1, anticorps XAP-3, anticorps XAP3, anticorps AC45, anticorps AI316502, anticorps AW108110, anticorps Atp6ip1, anticorps Atp6s1, anticorps C7-1, anticorps mFLJ00383, anticorps H+-ATPase, anticorps ATPase H+ transporting accessory protein 1, anticorps ATPase, H+ transporting, lysosomal accessory protein 1, anticorps plasma membrane ATPase 4, anticorps ATP6AP1, anticorps Atp6ap1, anticorps LOC547525

Sujet: This gene encodes a component of a multisubunit enzyme (1 mDa MW) that mediates acidification of eukaryotic intracellular organelles. Vacuolar ATPase (V-ATPase) is comprised of a cytosolic V1 (site of the ATP catalytic site) and a transmembrane V0 domain. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, and receptor-mediated endocytosis. The encoded protein of this gene is approximately 45 kDa and may assist in the V-ATPase-mediated acidification of neuroendocrine secretory granules.

Poids moléculaire: 52 kDa (MW of target protein)

Pathways: Proton Transport, SARS-CoV-2 Protein Interactome