RAPGEF3 anticorps

N° du produit ABIN633118

Cet anticorps Lapin Polyclonal détecte spécifiquement RAPGEF3 dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour RAPGEF3 anticorps (ABIN633118)

Antigène: RAPGEF3 (Rap Guanine Nucleotide Exchange Factor (GEF) 3 (RAPGEF3))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RAPGEF3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RAPGEF3 anticorps

Purification: Affinity purified

Immunogène: RAPGEF3 antibody was raised using a synthetic peptide corresponding to a region with amino acids RSQVVGICQVLLDEGALCHVKHDWAFQDRDAQFYRFPGPEPEPVGTHEME

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RAPGEF3 Blocking Peptide, (ABIN5615758), is also available for use as a blocking control in assays to test for specificity of this RAPGEF3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAPGEF3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RAPGEF3

Antigène: RAPGEF3 (Rap Guanine Nucleotide Exchange Factor (GEF) 3 (RAPGEF3))

Autre désignation: RAPGEF3

Sujet: RAPGEF3 is a guanine nucleotide exchange factor (GEF) for RAP1A and RAP2A small GTPases that is activated by binding cAMP.

Poids moléculaire: 99 kDa (MW of target protein)

Pathways: cAMP Metabolic Process