RAPGEF3 anticorps
-
- Antigène Voir toutes RAPGEF3 Anticorps
- RAPGEF3 (Rap Guanine Nucleotide Exchange Factor (GEF) 3 (RAPGEF3))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RAPGEF3 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- RAPGEF3 antibody was raised using a synthetic peptide corresponding to a region with amino acids RSQVVGICQVLLDEGALCHVKHDWAFQDRDAQFYRFPGPEPEPVGTHEME
- Top Product
- Discover our top product RAPGEF3 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RAPGEF3 Blocking Peptide, catalog no. 33R-8206, is also available for use as a blocking control in assays to test for specificity of this RAPGEF3 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAPGEF3 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RAPGEF3 (Rap Guanine Nucleotide Exchange Factor (GEF) 3 (RAPGEF3))
- Autre désignation
- RAPGEF3 (RAPGEF3 Produits)
- Synonymes
- anticorps RAPGEF3, anticorps epac, anticorps si:dkey-27m20.2, anticorps CAMP-GEFI, anticorps EPAC, anticorps EPAC1, anticorps HSU79275, anticorps bcm910, anticorps 2310016P22Rik, anticorps 9330170P05Rik, anticorps Epac, anticorps Epac1, anticorps Rap guanine nucleotide exchange factor 3, anticorps Rap guanine nucleotide exchange factor 3 S homeolog, anticorps Rap guanine nucleotide exchange factor (GEF) 3, anticorps RAPGEF3, anticorps rapgef3.S, anticorps rapgef3, anticorps Rapgef3
- Sujet
- RAPGEF3 is a guanine nucleotide exchange factor (GEF) for RAP1A and RAP2A small GTPases that is activated by binding cAMP.
- Poids moléculaire
- 99 kDa (MW of target protein)
- Pathways
- cAMP Metabolic Process
-