SUV39H2 anticorps

N° du produit ABIN633133

Détail du produit anti-SUV39H2 anticorps

Antigène: SUV39H2 (Suppressor of Variegation 3-9 Homolog 2 (Drosophila) (SUV39H2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SUV39H2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: SUV39 H2 antibody was raised using a synthetic peptide corresponding to a region with amino acids LDTRLPRIALFSTRTINAGEELTFDYQMKGSGDISSDSIDHSPAKKRVRT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SUV39H2 Blocking Peptide, catalog no. 33R-4870, is also available for use as a blocking control in assays to test for specificity of this SUV39H2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SUV30 2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SUV39H2

Antigène: SUV39H2 (Suppressor of Variegation 3-9 Homolog 2 (Drosophila) (SUV39H2))

Autre désignation: SUV39H2 (SUV39H2 Produits)

Synonymes: anticorps KMT1B, anticorps 4930507K23Rik, anticorps AA536750, anticorps D030054H19Rik, anticorps D2Ertd544e, anticorps SUV39H2, anticorps kmt1b, anticorps suppressor of variegation 3-9 homolog 2, anticorps suppressor of variegation 3-9 homolog 2 (Drosophila), anticorps suppressor of variegation 3-9 homolog 2 L homeolog, anticorps SUV39H2, anticorps Suv39h2, anticorps suv39h2, anticorps suv39h2.L

Sujet: SUV39H2 is a histone methyltransferase that specifically trimethylates 'Lys-9' of histone H3 using monomethylated H3 'Lys-9' as substrate. H3 'Lys-9' trimethylation represents a specific tag for epigenetic transcriptional repression by recruiting HP1 (CBX1, CBX3 and/or CBX5) proteins to methylated histones. Mainly functions in heterochromatin regions, thereby playing a central role in the establishment of constitutive heterochromatin at pericentric and telomere regions. H3 'Lys-9' trimethylation is also required to direct DNA methylation at pericentric repeats.

Poids moléculaire: 40 kDa (MW of target protein)