SAAL1 anticorps (Middle Region)

N° du produit ABIN633139

Détail du produit anti-SAAL1 anticorps

Antigène: SAAL1 (serum Amyloid A-Like 1 (SAAL1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SAAL1 est non-conjugé

Application: Western Blotting (WB)

Specificité: SAAL1 antibody was raised against the middle region of SAAL1

Purification: Affinity purified

Immunogène: SAAL1 antibody was raised using the middle region of SAAL1 corresponding to a region with amino acids EKLMLEWVRNGAAQPLDQPQEESEEQPVFRLVPCILEAAKQVRSENPEWL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SAAL1 Blocking Peptide, catalog no. 33R-2513, is also available for use as a blocking control in assays to test for specificity of this SAAL1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SAAL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SAAL1

Antigène: SAAL1 (serum Amyloid A-Like 1 (SAAL1))

Autre désignation: SAAL1 (SAAL1 Produits)

Synonymes: anticorps SPACIA1, anticorps 5031425D22Rik, anticorps zgc:55505, anticorps serum amyloid A like 1, anticorps serum amyloid A-like 1, anticorps SAAL1, anticorps Saal1, anticorps saal1

Sujet: The function of SAA protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 53 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome