SAAL1 anticorps (Middle Region)
-
- Antigène Voir toutes SAAL1 Anticorps
- SAAL1 (serum Amyloid A-Like 1 (SAAL1))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SAAL1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- SAAL1 antibody was raised against the middle region of SAAL1
- Purification
- Affinity purified
- Immunogène
- SAAL1 antibody was raised using the middle region of SAAL1 corresponding to a region with amino acids EKLMLEWVRNGAAQPLDQPQEESEEQPVFRLVPCILEAAKQVRSENPEWL
- Top Product
- Discover our top product SAAL1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SAAL1 Blocking Peptide, catalog no. 33R-2513, is also available for use as a blocking control in assays to test for specificity of this SAAL1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SAAL1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SAAL1 (serum Amyloid A-Like 1 (SAAL1))
- Autre désignation
- SAAL1 (SAAL1 Produits)
- Synonymes
- anticorps SPACIA1, anticorps 5031425D22Rik, anticorps zgc:55505, anticorps serum amyloid A like 1, anticorps serum amyloid A-like 1, anticorps SAAL1, anticorps Saal1, anticorps saal1
- Sujet
- The function of SAA protein is not widely studied, and is yet to be elucidated fully.
- Poids moléculaire
- 53 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interactome
-