FGF2 anticorps

N° du produit ABIN633176

Détail du produit anti-FGF2 anticorps

Antigène: FGF2 (Fibroblast Growth Factor 2 (Basic) (FGF2))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FGF2 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: FGF2 antibody was raised using a synthetic peptide corresponding to a region with amino acids RLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FGF2 Blocking Peptide, catalog no. 33R-8018, is also available for use as a blocking control in assays to test for specificity of this FGF2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FGF2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FGF2

Antigène: FGF2 (Fibroblast Growth Factor 2 (Basic) (FGF2))

Autre désignation: FGF2 (FGF2 Produits)

Synonymes: anticorps BFGF, anticorps FGF-2, anticorps FGFB, anticorps HBGF-2, anticorps Fgf-2, anticorps Fgfb, anticorps bFGF, anticorps fibroblast growth factor 2, anticorps fibroblast growth factor 2 (basic), anticorps FGF2, anticorps Fgf2, anticorps fgf2

Sujet: The heparin-binding growth factors are angiogenic agents in vivo and are potent mitogens for a variety of cell types in vitro. There are differences in the tissue distribution and concentration of these 2 growth factors.

Poids moléculaire: 31 kDa (MW of target protein)

Pathways: Signalisation RTK, Fc-epsilon Receptor Signaling Pathway, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, C21-Steroid Hormone Metabolic Process, Inositol Metabolic Process, Glycosaminoglycan Metabolic Process, Protein targeting to Nucleus, S100 Proteins