SFRS6 anticorps (Middle Region)

N° du produit ABIN633190

Détail du produit anti-SFRS6 anticorps

Antigène: SFRS6 (SRSF6) (serine/arginine-Rich Splicing Factor 6 (SRSF6))

Épitope: Middle Region

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SFRS6 est non-conjugé

Application: Western Blotting (WB)

Specificité: SFRS6 antibody was raised against the middle region of SFRS6

Purification: Affinity purified

Immunogène: SFRS6 antibody was raised using the middle region of SFRS6 corresponding to a region with amino acids KERTNEGVIEFRSYSDMKRALDKLDGTEINGRNIRLIEDKPRTSHRRSYS

Information d'application

Indications d'application: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SFRS6 Blocking Peptide, catalog no. 33R-4356, is also available for use as a blocking control in assays to test for specificity of this SFRS6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SFRS6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SFRS6

Antigène: SFRS6 (SRSF6) (serine/arginine-Rich Splicing Factor 6 (SRSF6))

Autre désignation: SFRS6 (SRSF6 Produits)

Synonymes: anticorps B52, anticorps SFRS6, anticorps SRP55, anticorps 1210001E11Rik, anticorps AI314910, anticorps AW146126, anticorps Sfrs6, anticorps b52, anticorps sfrs6, anticorps srp55, anticorps sfrs6b, anticorps wu:faa54g02, anticorps wu:fc17h09, anticorps zgc:103497, anticorps fa12h12, anticorps sfrs6a, anticorps wu:fa12h12, anticorps wu:fa13e06, anticorps zgc:63770, anticorps serine and arginine rich splicing factor 6, anticorps serine/arginine-rich splicing factor 6, anticorps serine/arginine-rich splicing factor 6 S homeolog, anticorps serine/arginine-rich splicing factor 6b, anticorps serine/arginine-rich splicing factor 6a, anticorps SRSF6, anticorps Srsf6, anticorps srsf6.S, anticorps srsf6b, anticorps srsf6a

Sujet: SFRS6 is involved in mRNA splicing and may play a role in the determination of alternative splicing. It belongs to the splicing factor SR family and has been shown to bind with and modulate another member of the family, SFRS12.

Poids moléculaire: 39 kDa (MW of target protein)

Pathways: Ribonucleoprotein Complex Subunit Organization