RENT1/UPF1 anticorps

N° du produit ABIN633191

Détail du produit anti-RENT1/UPF1 anticorps

Antigène: RENT1/UPF1 (UPF1) (UPF1 Regulator of Nonsense Transcripts Homolog (UPF1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RENT1/UPF1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: UPF1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RGTPKGKTGRGGRQKNRFGLPGPSQTNLPNSQASQDVASQPFSQGALTQG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UPF1 Blocking Peptide, catalog no. 33R-7945, is also available for use as a blocking control in assays to test for specificity of this UPF1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UPF1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RENT1/UPF1

Antigène: RENT1/UPF1 (UPF1) (UPF1 Regulator of Nonsense Transcripts Homolog (UPF1))

Autre désignation: UPF1 (UPF1 Produits)

Synonymes: anticorps HUPF1, anticorps NORF1, anticorps RENT1, anticorps pNORF1, anticorps smg-2, anticorps B430202H16Rik, anticorps PNORF-1, anticorps Rent1, anticorps Upflp, anticorps rent1, anticorps wu:fi40f07, anticorps wu:fj48a01, anticorps zgc:55472, anticorps Tb05.3C6.50, anticorps AO090012000584, anticorps hupf1, anticorps norf1, anticorps pnorf1, anticorps upf1, anticorps UPF1, RNA helicase and ATPase, anticorps UPF1 regulator of nonsense transcripts homolog (yeast), anticorps upf1 regulator of nonsense transcripts homolog (yeast), anticorps regulator of nonsense transcripts 1, anticorps Regulator of nonsense transcripts 1, anticorps UPF1 regulator of nonsense transcripts homolog S homeolog, anticorps UPF1, anticorps Upf1, anticorps upf1, anticorps Tc00.1047053511317.30, anticorps Tb927.5.2140, anticorps TVAG_453890, anticorps TVAG_237840, anticorps AOR_1_1018194, anticorps HPB8_739, anticorps smg-2, anticorps upf1.S

Sujet: UPF1 is a protein that is part of a post-splicing multiprotein complex involved in both mRNA nuclear export and mRNA surveillance. mRNA surveillance detects exported mRNAs with truncated open reading frames and initiates nonsense-mediated mRNA decay (NMD). When translation ends upstream from the last exon-exon junction, this triggers NMD to degrade mRNAs containing premature stop codons.

Poids moléculaire: 123 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interactome