DROSHA anticorps (Middle Region)

N° du produit ABIN633216

Détail du produit anti-DROSHA anticorps

Antigène: DROSHA (Drosha, Ribonuclease Type III (DROSHA))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DROSHA est non-conjugé

Application: Western Blotting (WB)

Specificité: RNASEN antibody was raised against the middle region of RNASEN

Purification: Affinity purified

Immunogène: RNASEN antibody was raised using the middle region of RNASEN corresponding to a region with amino acids AAMDALEKYNFPQMAHQKRFIERKYRQELKEMRWEREHQEREPDETEDIK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RNASEN Blocking Peptide, catalog no. 33R-1038, is also available for use as a blocking control in assays to test for specificity of this RNASEN antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNASEN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DROSHA

Antigène: DROSHA (Drosha, Ribonuclease Type III (DROSHA))

Autre désignation: RNASEN (DROSHA Produits)

Synonymes: anticorps im:7150667, anticorps zgc:158612, anticorps ETOHI2, anticorps HSA242976, anticorps RANSE3L, anticorps RN3, anticorps RNASE3L, anticorps RNASEN, anticorps 1110013A17Rik, anticorps AI874853, anticorps Etohi2, anticorps Rn3, anticorps Rnasen, anticorps RGD1307626, anticorps ribonuclease type III, nuclear, anticorps Ribonuclease 3, anticorps ribonuclease 3, anticorps drosha ribonuclease III, anticorps drosha, ribonuclease type III, anticorps rnasen, anticorps Thicy_0885, anticorps Sinme_0866, anticorps Isova_2087, anticorps Sphch_0770, anticorps DROSHA, anticorps Drosha

Sujet: RNASEN is a ribonuclease III double-stranded (ds) RNA-specific endoribonuclease that is involved in the initial step of microRNA (miRNA) biogenesis. Component of the microprocessor complex that is required to process primary miRNA transcripts (pri-miRNAs) to release precursor miRNA (pre-miRNA) in the nucleus.

Poids moléculaire: 159 kDa (MW of target protein)

Pathways: Regulatory RNA Pathways