LARP7 anticorps (C-Term)
-
- Antigène Voir toutes LARP7 Anticorps
- LARP7 (La Ribonucleoprotein Domain Family, Member 7 (LARP7))
-
Épitope
- C-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp LARP7 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- LARP7 antibody was raised against the C terminal of LARP7
- Purification
- Affinity purified
- Immunogène
- LARP7 antibody was raised using the C terminal of LARP7 corresponding to a region with amino acids WQKILVDRQAKLNQPREKKRGTEKLITKAEKIRLAKTQQASKHIRFSEYD
- Top Product
- Discover our top product LARP7 Anticorps primaire
-
-
- Indications d'application
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
LARP7 Blocking Peptide, catalog no. 33R-9993, is also available for use as a blocking control in assays to test for specificity of this LARP7 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LARP7 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- LARP7 (La Ribonucleoprotein Domain Family, Member 7 (LARP7))
- Autre désignation
- LARP7 (LARP7 Produits)
- Synonymes
- anticorps ALAZS, anticorps PIP7S, anticorps LARP7, anticorps C330027G06Rik, anticorps D3Wsu161e, anticorps fa10g04, anticorps wu:fa10g04, anticorps zgc:56476, anticorps La ribonucleoprotein domain family member 7, anticorps La ribonucleoprotein domain family, member 7, anticorps la-related protein 7, anticorps La ribonucleoprotein domain family, member 7-like, anticorps LARP7, anticorps Larp7, anticorps larp7, anticorps LOC100222278, anticorps LOC100627397
- Sujet
- LARP7 is involved in RNA binding and nucleotide binding.
- Poids moléculaire
- 67 kDa (MW of target protein)
- Pathways
- Chromatin Binding, SARS-CoV-2 Protein Interactome, Phosphorylation & l'infection par le SRAS-CoV-2
-