KCNAB1 anticorps (C-Term)

N° du produit ABIN633614

Détail du produit anti-KCNAB1 anticorps

Antigène: KCNAB1 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, beta Member 1 (KCNAB1))

Épitope: C-Term

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KCNAB1 est non-conjugé

Application: Western Blotting (WB)

Specificité: KCNAB1 antibody was raised against the C terminal of KCNAB1

Purification: Affinity purified

Immunogène: KCNAB1 antibody was raised using the C terminal of KCNAB1 corresponding to a region with amino acids VPESSRASLKCYQWLKERIVSEEGRKQQNKLKDLSPIAERLGCTLPQLAV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KCNAB1 Blocking Peptide, catalog no. 33R-9721, is also available for use as a blocking control in assays to test for specificity of this KCNAB1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNAB1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KCNAB1

Antigène: KCNAB1 (Potassium Voltage-Gated Channel, Shaker-Related Subfamily, beta Member 1 (KCNAB1))

Autre désignation: KCNAB1 (KCNAB1 Produits)

Synonymes: anticorps KCNAB1, anticorps zgc:113627, anticorps AKR6A3, anticorps KCNA1B, anticorps KV-BETA-1, anticorps Kvb1.3, anticorps hKvBeta3, anticorps hKvb3, anticorps Kvbeta1.1, anticorps KVBETA1, anticorps Kv-beta-1, anticorps Akr8a8, anticorps mKv(beta)1, anticorps KvBeta3, anticorps potassium voltage-gated channel subfamily A member regulatory beta subunit 1, anticorps potassium voltage-gated channel, shaker-related subfamily, beta member 1 a, anticorps potassium voltage-gated channel, shaker-related subfamily, beta member 1, anticorps KCNAB1, anticorps kcnab1a, anticorps Kcnab1

Sujet: Potassium channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume.

Poids moléculaire: 46 kDa (MW of target protein)