SCN5A anticorps (C-Term)

N° du produit ABIN633685

Détail du produit anti-SCN5A anticorps

Antigène: SCN5A (Sodium Channel, Voltage-Gated, Type V, alpha Subunit (SCN5A))

Épitope: C-Term

Reactivité: Humain, Souris, Rat, Chien, Poisson zèbre (Danio rerio)

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp SCN5A est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: SCN5 A antibody was raised against the C terminal of SCN5

Purification: Affinity purified

Immunogène: SCN5 A antibody was raised using the C terminal of SCN5 corresponding to a region with amino acids FTKRVLGESGEMDALKIQMEEKFMAANPSKISYEPITTTLRRKHEEVSAM

Information d'application

Indications d'application: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

SCN5A Blocking Peptide, catalog no. 33R-3093, is also available for use as a blocking control in assays to test for specificity of this SCN5A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCN0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur SCN5A

Antigène: SCN5A (Sodium Channel, Voltage-Gated, Type V, alpha Subunit (SCN5A))

Autre désignation: SCN5A (SCN5A Produits)

Synonymes: anticorps Nav1.5, anticorps Nav1.5c, anticorps SkM1, anticorps SkM2, anticorps mH1, anticorps CDCD2, anticorps CMD1E, anticorps CMPD2, anticorps HB1, anticorps HB2, anticorps HBBD, anticorps HH1, anticorps ICCD, anticorps IVF, anticorps LQT3, anticorps PFHB1, anticorps SSS1, anticorps VF1, anticorps SCAL, anticorps sodium voltage-gated channel alpha subunit 5, anticorps sodium channel, voltage-gated, type V, alpha, anticorps SCN5A, anticorps Scn5a

Sujet: SCN5A is an integral membrane protein and tetrodotoxin-resistant voltage-gated sodium channel subunit. The protein is found primarily in cardiac muscle and is responsible for the initial upstroke of the action potential in an electrocardiogram.

Poids moléculaire: 222 kDa (MW of target protein)