SCN5A anticorps (C-Term)
-
- Antigène Voir toutes SCN5A Anticorps
- SCN5A (Sodium Channel, Voltage-Gated, Type V, alpha Subunit (SCN5A))
-
Épitope
- C-Term
-
Reactivité
- Humain, Souris, Rat, Chien, Poisson zèbre (Danio rerio)
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp SCN5A est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- SCN5 A antibody was raised against the C terminal of SCN5
- Purification
- Affinity purified
- Immunogène
- SCN5 A antibody was raised using the C terminal of SCN5 corresponding to a region with amino acids FTKRVLGESGEMDALKIQMEEKFMAANPSKISYEPITTTLRRKHEEVSAM
- Top Product
- Discover our top product SCN5A Anticorps primaire
-
-
- Indications d'application
-
WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
SCN5A Blocking Peptide, catalog no. 33R-3093, is also available for use as a blocking control in assays to test for specificity of this SCN5A antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SCN0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- SCN5A (Sodium Channel, Voltage-Gated, Type V, alpha Subunit (SCN5A))
- Autre désignation
- SCN5A (SCN5A Produits)
- Synonymes
- anticorps Nav1.5, anticorps Nav1.5c, anticorps SkM1, anticorps SkM2, anticorps mH1, anticorps CDCD2, anticorps CMD1E, anticorps CMPD2, anticorps HB1, anticorps HB2, anticorps HBBD, anticorps HH1, anticorps ICCD, anticorps IVF, anticorps LQT3, anticorps PFHB1, anticorps SSS1, anticorps VF1, anticorps SCAL, anticorps sodium voltage-gated channel alpha subunit 5, anticorps sodium channel, voltage-gated, type V, alpha, anticorps SCN5A, anticorps Scn5a
- Sujet
- SCN5A is an integral membrane protein and tetrodotoxin-resistant voltage-gated sodium channel subunit. The protein is found primarily in cardiac muscle and is responsible for the initial upstroke of the action potential in an electrocardiogram.
- Poids moléculaire
- 222 kDa (MW of target protein)
-