P2RX7 anticorps (Middle Region)
-
- Antigène Voir toutes P2RX7 Anticorps
- P2RX7 (Purinergic Receptor P2X, Ligand-Gated Ion Channel, 7 (P2RX7))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp P2RX7 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- P2 RX7 antibody was raised against the middle region of P2 X7
- Purification
- Affinity purified
- Immunogène
- P2 RX7 antibody was raised using the middle region of P2 X7 corresponding to a region with amino acids LRHCAYRCYATWRFGSQDMADFANLPSCCRWRIRKEFPKSEGQYSGFKSP
- Top Product
- Discover our top product P2RX7 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
P2RX7 Blocking Peptide, catalog no. 33R-5361, is also available for use as a blocking control in assays to test for specificity of this P2RX7 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of P0 X7 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- P2RX7 (Purinergic Receptor P2X, Ligand-Gated Ion Channel, 7 (P2RX7))
- Autre désignation
- P2RX7 (P2RX7 Produits)
- Synonymes
- anticorps p2xr7, anticorps P2RX7, anticorps P2X7, anticorps AI467586, anticorps P2X(7), anticorps P2X7R, anticorps p2x7, anticorps purinergic receptor P2X 7, anticorps purinergic receptor P2X, ligand-gated ion channel, 7, anticorps P2X purinoceptor 7, anticorps P2RX7, anticorps p2rx7, anticorps LOC100458463, anticorps P2rx7
- Sujet
- The product P2RX7 belongs to the family of purinoceptors for ATP. This receptor functions as a ligand-gated ion channel and is responsible for ATP-dependent lysis of macrophages through the formation of membrane pores permeable to large molecules. Activation of this nuclear receptor by ATP in the cytoplasm may be a mechanism by which cellular activity can be coupled to changes in gene expression.
- Poids moléculaire
- 68 kDa (MW of target protein)
- Pathways
- Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Synaptic Vesicle Exocytosis
-