KCNJ1 anticorps (Middle Region)

N° du produit ABIN633717

Détail du produit anti-KCNJ1 anticorps

Antigène: KCNJ1 (Potassium Inwardly-Rectifying Channel, Subfamily J, Member 1 (KCNJ1))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp KCNJ1 est non-conjugé

Application: Western Blotting (WB)

Specificité: KCNJ1 antibody was raised against the middle region of KCNJ1

Purification: Affinity purified

Immunogène: KCNJ1 antibody was raised using the middle region of KCNJ1 corresponding to a region with amino acids LRKSLLIGSHIYGKLLKTTVTPEGETIILDQININFVVDAGNENLFFISP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KCNJ1 Blocking Peptide, catalog no. 33R-5365, is also available for use as a blocking control in assays to test for specificity of this KCNJ1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KCNJ1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur KCNJ1

Antigène: KCNJ1 (Potassium Inwardly-Rectifying Channel, Subfamily J, Member 1 (KCNJ1))

Autre désignation: KCNJ1 (KCNJ1 Produits)

Synonymes: anticorps KIR1.1, anticorps ROMK, anticorps ROMK1, anticorps kir1.1, anticorps romk1, anticorps Kcnj, anticorps Kir1.1, anticorps Romk2, anticorps kcnj1, anticorps wu:fl37c05, anticorps zgc:63534, anticorps potassium voltage-gated channel subfamily J member 1, anticorps potassium voltage-gated channel subfamily J member 1 L homeolog, anticorps potassium inwardly-rectifying channel, subfamily J, member 1, anticorps potassium inwardly-rectifying channel, subfamily J, member 1a, tandem duplicate 1, anticorps KCNJ1, anticorps kcnj1.L, anticorps kcnj1, anticorps Kcnj1, anticorps kcnj1a.1

Sujet: KCNJ1 has a greater tendency to allow potassium to flow into a cell rather than out of a cell. Mutations in this gene have been associated with antenatal Bartter syndrome, which is characterized by salt wasting, hypokalemic alkalosis, hypercalciuria, and low blood pressure. Multiple transcript variants encoding different isoforms have been found for KCNJ1.

Poids moléculaire: 45 kDa (MW of target protein)