CACNA1G anticorps (Middle Region)

N° du produit ABIN633723

Détail du produit anti-CACNA1G anticorps

Antigène: CACNA1G (Calcium Channel, Voltage-Dependent, T Type, alpha 1G Subunit (CACNA1G))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp CACNA1G est non-conjugé

Application: Western Blotting (WB)

Specificité: CACNA1 G antibody was raised against the middle region of CACNA1

Purification: Affinity purified

Immunogène: CACNA1 G antibody was raised using the middle region of CACNA1 corresponding to a region with amino acids VSRTHSLPNDSYMCRHGSTAEGPLGHRGWGLPKAQSGSVLSVHSQPADTS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

CACNA1G Blocking Peptide, catalog no. 33R-9823, is also available for use as a blocking control in assays to test for specificity of this CACNA1G antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CACNA0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur CACNA1G

Antigène: CACNA1G (Calcium Channel, Voltage-Dependent, T Type, alpha 1G Subunit (CACNA1G))

Autre désignation: CACNA1G (CACNA1G Produits)

Synonymes: anticorps CACNA1G, anticorps cav3.1, anticorps ca(v)3.1, anticorps Ca(V)T.1, anticorps Cav3.1, anticorps NBR13, anticorps Cav3.1d, anticorps [a]1G, anticorps a1G, anticorps alpha-1G, anticorps mKIAA1123, anticorps Ca(v)3.1, anticorps calcium voltage-gated channel subunit alpha1 G, anticorps calcium channel, voltage-dependent, T type, alpha 1G subunit, anticorps calcium channel, voltage-dependent, T type, alpha 1G subunit L homeolog, anticorps CACNA1G, anticorps cacna1g, anticorps cacna1g.L, anticorps Cacna1g

Sujet: Voltage-activated calcium channels can be distinguished based on their voltage-dependence, deactivation, and single-channel conductance.

Poids moléculaire: 241 kDa (MW of target protein)