NR2E1 anticorps (Middle Region)

N° du produit ABIN633801

Détail du produit anti-NR2E1 anticorps

Antigène: NR2E1 (Nuclear Receptor Subfamily 2, Group E, Member 1 (NR2E1))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NR2E1 est non-conjugé

Application: Western Blotting (WB)

Specificité: NR2 E1 antibody was raised against the middle region of NR2 1

Purification: Affinity purified

Immunogène: NR2 E1 antibody was raised using the middle region of NR2 1 corresponding to a region with amino acids LAAVSTTPERQTLVSLAQPTPKYPHEVNGTPMYLYEVATESVCESAARLL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NR2E1 Blocking Peptide, catalog no. 33R-4758, is also available for use as a blocking control in assays to test for specificity of this NR2E1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NR0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NR2E1

Antigène: NR2E1 (Nuclear Receptor Subfamily 2, Group E, Member 1 (NR2E1))

Autre désignation: NR2E1 (NR2E1 Produits)

Synonymes: anticorps NR2E1, anticorps TLL, anticorps TLX, anticorps XTLL, anticorps Mtl1, anticorps Mtll, anticorps Tlx, anticorps fierce, anticorps frc, anticorps tailless, anticorps fc30e03, anticorps fc39f12, anticorps wu:fc30e03, anticorps wu:fc39f12, anticorps zgc:100991, anticorps Xtll, anticorps nr2e1-A, anticorps tlx, anticorps nuclear receptor subfamily 2 group E member 1, anticorps nuclear receptor subfamily 2, group E, member 1, anticorps nuclear receptor subfamily 2 group E member 1 S homeolog, anticorps NR2E1, anticorps Nr2e1, anticorps nr2e1, anticorps nr2e1.S

Sujet: The NR2E1 gene is a member of the steroid nuclear receptor superfamily and is predominately expressed in the brain. The contributions of this gene to human B-cell leukemia and to brain development are unknown at present.

Poids moléculaire: 42 kDa (MW of target protein)

Pathways: Nuclear Receptor Transcription Pathway, Steroid Hormone Mediated Signaling Pathway, Stem Cell Maintenance