GSTM3 anticorps

N° du produit ABIN633805

Détail du produit anti-GSTM3 anticorps

Antigène: GSTM3 (Glutathione S-Transferase mu 3 (Brain) (GSTM3))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GSTM3 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: GSTM3 antibody was raised using a synthetic peptide corresponding to a region with amino acids SMFLGKFSWFAGEKLTFVDFLTYDILDQNRIFDPKCLDEFPNLKAFMCRF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GSTM3 Blocking Peptide, catalog no. 33R-8636, is also available for use as a blocking control in assays to test for specificity of this GSTM3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GSTM3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GSTM3

Antigène: GSTM3 (Glutathione S-Transferase mu 3 (Brain) (GSTM3))

Autre désignation: GSTM3 (GSTM3 Produits)

Synonymes: anticorps GST5, anticorps GSTB, anticorps GSTM3-3, anticorps GTM3, anticorps Fsc2, anticorps mGSTM5, anticorps glutathione S-transferase mu 3, anticorps glutathione S-transferase Mu 3, anticorps glutathione S-transferase, mu 3, anticorps GSTM3, anticorps Gstm3, anticorps LOC479911

Sujet: Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. GSTM3 is a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione.

Poids moléculaire: 26 kDa (MW of target protein)