FGA anticorps (Middle Region)
-
- Antigène Voir toutes FGA Anticorps
- FGA (Fibrinogen alpha Chain (FGA))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp FGA est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Fibrinogen Alpha antibody was raised against the middle region of FGA
- Purification
- Affinity purified
- Immunogène
- Fibrinogen Alpha antibody was raised using the middle region of FGA corresponding to a region with amino acids SSSYSKQFTSSTSYNRGDSTFESKSYKMADEAGSEADHEGTHSTKRGHAK
- Top Product
- Discover our top product FGA Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Fibrinogen Alpha Blocking Peptide, catalog no. 33R-8855, is also available for use as a blocking control in assays to test for specificity of this Fibrinogen Alpha antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FGA antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- FGA (Fibrinogen alpha Chain (FGA))
- Autre désignation
- Fibrinogen alpha (FGA Produits)
- Synonymes
- anticorps Fib2, anticorps ENSMUSG00000059807, anticorps Fib, anticorps Ac1873, anticorps Fba5e, anticorps fibrinogen alpha chain, anticorps FGA, anticorps Fga, anticorps LOC698244
- Sujet
- FGA is the alpha component of fibrinogen, a blood-borne glycoprotein comprised of three pairs of nonidentical polypeptide chains. Following vascular injury, fibrinogen is cleaved by thrombin to form fibrin which is the most abundant component of blood clots. In addition, various cleavage products of fibrinogen and fibrin regulate cell adhesion and spreading, display vasoconstrictor and chemotactic activities, and are mitogens for several cell types. Mutations in its gene lead to several disorders, including dysfibrinogenemia, hypofibrinogenemia, afibrinogenemia and renal amyloidosis.
- Poids moléculaire
- 66 kDa (MW of target protein)
-