WNT5B anticorps (Middle Region)
-
- Antigène Voir toutes WNT5B Anticorps
- WNT5B (Wingless-Type MMTV Integration Site Family, Member 5B (WNT5B))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp WNT5B est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- WNT5 B antibody was raised against the middle region of WNT5
- Purification
- Affinity purified
- Immunogène
- WNT5 B antibody was raised using the middle region of WNT5 corresponding to a region with amino acids YCLRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYNQFKSVQVERCHC
- Top Product
- Discover our top product WNT5B Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
WNT5B Blocking Peptide, catalog no. 33R-10059, is also available for use as a blocking control in assays to test for specificity of this WNT5B antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WNT0 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- WNT5B (Wingless-Type MMTV Integration Site Family, Member 5B (WNT5B))
- Autre désignation
- WNT5B (WNT5B Produits)
- Synonymes
- anticorps wnt-5b, anticorps xwnt5b, anticorps WNT5B, anticorps AW545702, anticorps Wnt-5b, anticorps xwnt-5c, anticorps CHUNP6928, anticorps id:ibd5111, anticorps ppt, anticorps wnt-5, anticorps wnt5, anticorps wnt[b], anticorps wu:fk85g06, anticorps Wnt family member 5B, anticorps wingless-type MMTV integration site family, member 5B, anticorps Wnt family member 5B S homeolog, anticorps wingless-type MMTV integration site family, member 5b, anticorps wnt5b, anticorps WNT5B, anticorps Wnt5b, anticorps wnt5b.S
- Sujet
- The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes.
- Poids moléculaire
- 39 kDa (MW of target protein)
- Pathways
- Signalisation WNT, Embryonic Body Morphogenesis, Positive Regulation of fat Cell Differentiation
-