HRG anticorps (Middle Region)

N° du produit ABIN633866

Détail du produit anti-HRG anticorps

Antigène: HRG (Histidine-Rich Glycoprotein (HRG))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HRG est non-conjugé

Application: Western Blotting (WB)

Specificité: HRG antibody was raised against the middle region of HRG

Purification: Affinity purified

Immunogène: HRG antibody was raised using the middle region of HRG corresponding to a region with amino acids HHPHKPHEHGPPPPPDERDHSHGPPLPQGPPPLLPMSCSSCQHATFGTNG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HRG Blocking Peptide, catalog no. 33R-3749, is also available for use as a blocking control in assays to test for specificity of this HRG antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HRG antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HRG

Antigène: HRG (Histidine-Rich Glycoprotein (HRG))

Autre désignation: HRG (HRG Produits)

Synonymes: anticorps AI265597, anticorps AW413091, anticorps D16jh2, anticorps D18020, anticorps Hprg, anticorps Hrgp, anticorps HPRG, anticorps HRGP, anticorps THPH11, anticorps HRG1, anticorps histidine rich glycoprotein, anticorps histidine-rich glycoprotein, anticorps HRG, anticorps LOAG_12427, anticorps LOC100597044, anticorps Hrg

Sujet: This histidine-rich glycoprotein(HRG) contains two cystatin-like domains and is located in plasma and platelets. The physiological function has not been determined but it is known that the protein binds heme, dyes and divalent metal ions.

Poids moléculaire: 58 kDa (MW of target protein)