HRG anticorps (Middle Region)

N° du produit ABIN633866

L’anticorps anti-HRG Polyclonal Lapin est utilisé pour la détection de HRG dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour HRG anticorps (Middle Region) (ABIN633866)

Antigène: HRG (Histidine-Rich Glycoprotein (HRG))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp HRG est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-HRG anticorps

Épitope: Middle Region

Specificité: HRG antibody was raised against the middle region of HRG

Purification: Affinity purified

Immunogène: HRG antibody was raised using the middle region of HRG corresponding to a region with amino acids HHPHKPHEHGPPPPPDERDHSHGPPLPQGPPPLLPMSCSSCQHATFGTNG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

HRG Blocking Peptide, (ABIN939135), is also available for use as a blocking control in assays to test for specificity of this HRG antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HRG antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur HRG

Antigène: HRG (Histidine-Rich Glycoprotein (HRG))

Autre désignation: HRG

Sujet: This histidine-rich glycoprotein(HRG) contains two cystatin-like domains and is located in plasma and platelets. The physiological function has not been determined but it is known that the protein binds heme, dyes and divalent metal ions.

Poids moléculaire: 58 kDa (MW of target protein)