RDH12 anticorps
-
- Antigène Voir toutes RDH12 Anticorps
- RDH12 (Retinol Dehydrogenase 12 (All-Trans/9-Cis/11-Cis) (RDH12))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RDH12 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- RDH12 antibody was raised using a synthetic peptide corresponding to a region with amino acids AKRLQGTGVTTYAVHPGVVRSELVRHSSLLCLLWRLFSPFVKTAREGAQT
- Top Product
- Discover our top product RDH12 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RDH12 Blocking Peptide, catalog no. 33R-1308, is also available for use as a blocking control in assays to test for specificity of this RDH12 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RDH12 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RDH12 (Retinol Dehydrogenase 12 (All-Trans/9-Cis/11-Cis) (RDH12))
- Autre désignation
- RDH12 (RDH12 Produits)
- Synonymes
- anticorps wu:fj43a10, anticorps zgc:92430, anticorps A930033N07Rik, anticorps LCA13, anticorps LCA3, anticorps RP53, anticorps SDR7C2, anticorps DSSDR2, anticorps retinol dehydrogenase 12 (all-trans/9-cis/11-cis), anticorps retinol dehydrogenase 12, anticorps Retinol dehydrogenase 12, anticorps RDH12, anticorps rdh12, anticorps MAV_1968, anticorps CC1G_02720, anticorps Bm1_36660, anticorps PTRG_03574, anticorps PTRG_05326, anticorps PTRG_08067, anticorps LOC100282710, anticorps LOC100285880, anticorps LOC100226769, anticorps Rdh12
- Sujet
- RDH12 is an NADPH-dependent retinal reductase whose highest activity is toward 9-cis and all-trans-retinol. RDH12 also plays a role in the metabolism of short-chain aldehydes but does not exhibit steroid dehydrogenase activity. Defects in this gene are a cause of Leber congenital amaurosis type 3 (LCA3). The protein encoded by this gene is an NADPH-dependent retinal reductase whose highest activity is toward 9-cis and all-trans-retinol. The encoded enzyme also plays a role in the metabolism of short-chain aldehydes but does not exhibit steroid dehydrogenase activity. Defects in this gene are a cause of Leber congenital amaurosis type 3 (LCA3).
- Poids moléculaire
- 35 kDa (MW of target protein)
-