RDH12 anticorps

N° du produit ABIN634023

Détail du produit anti-RDH12 anticorps

Antigène: RDH12 (Retinol Dehydrogenase 12 (All-Trans/9-Cis/11-Cis) (RDH12))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RDH12 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: RDH12 antibody was raised using a synthetic peptide corresponding to a region with amino acids AKRLQGTGVTTYAVHPGVVRSELVRHSSLLCLLWRLFSPFVKTAREGAQT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RDH12 Blocking Peptide, catalog no. 33R-1308, is also available for use as a blocking control in assays to test for specificity of this RDH12 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RDH12 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RDH12

Antigène: RDH12 (Retinol Dehydrogenase 12 (All-Trans/9-Cis/11-Cis) (RDH12))

Autre désignation: RDH12 (RDH12 Produits)

Synonymes: anticorps wu:fj43a10, anticorps zgc:92430, anticorps A930033N07Rik, anticorps LCA13, anticorps LCA3, anticorps RP53, anticorps SDR7C2, anticorps DSSDR2, anticorps retinol dehydrogenase 12 (all-trans/9-cis/11-cis), anticorps retinol dehydrogenase 12, anticorps Retinol dehydrogenase 12, anticorps RDH12, anticorps rdh12, anticorps MAV_1968, anticorps CC1G_02720, anticorps Bm1_36660, anticorps PTRG_03574, anticorps PTRG_05326, anticorps PTRG_08067, anticorps LOC100282710, anticorps LOC100285880, anticorps LOC100226769, anticorps Rdh12

Sujet: RDH12 is an NADPH-dependent retinal reductase whose highest activity is toward 9-cis and all-trans-retinol. RDH12 also plays a role in the metabolism of short-chain aldehydes but does not exhibit steroid dehydrogenase activity. Defects in this gene are a cause of Leber congenital amaurosis type 3 (LCA3). The protein encoded by this gene is an NADPH-dependent retinal reductase whose highest activity is toward 9-cis and all-trans-retinol. The encoded enzyme also plays a role in the metabolism of short-chain aldehydes but does not exhibit steroid dehydrogenase activity. Defects in this gene are a cause of Leber congenital amaurosis type 3 (LCA3).

Poids moléculaire: 35 kDa (MW of target protein)