ASAH1 anticorps

N° du produit ABIN634056

Détail du produit anti-ASAH1 anticorps

Antigène: ASAH1 (N-Acylsphingosine Amidohydrolase (Acid Ceramidase) 1 (ASAH1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ASAH1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: ASAH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MPGRSCVALVLLAAAVSCAVAQHAPPWTEDCRKSTYPPSGPTYRGAVPWY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ASAH1 Blocking Peptide, catalog no. 33R-6282, is also available for use as a blocking control in assays to test for specificity of this ASAH1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ASAH1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ASAH1

Antigène: ASAH1 (N-Acylsphingosine Amidohydrolase (Acid Ceramidase) 1 (ASAH1))

Autre désignation: ASAH1 (ASAH1 Produits)

Synonymes: anticorps AC, anticorps ACDase, anticorps ASAH, anticorps PHP, anticorps PHP32, anticorps SMAPME, anticorps 2310081N20Rik, anticorps Asah, anticorps MGC82286, anticorps asah1, anticorps zgc:101637, anticorps ASAH1, anticorps zgc:66026, anticorps N-acylsphingosine amidohydrolase 1, anticorps N-acylsphingosine amidohydrolase (acid ceramidase) 1, anticorps N-acylsphingosine amidohydrolase (acid ceramidase) 1 L homeolog, anticorps N-acylsphingosine amidohydrolase (acid ceramidase) 1a, anticorps Acid ceramidase, anticorps N-acylsphingosine amidohydrolase (acid ceramidase) 1b, anticorps ASAH1, anticorps Asah1, anticorps asah1.L, anticorps asah1a, anticorps asah-1, anticorps asah1b

Sujet: This gene encodes a heterodimeric protein consisting of a nonglycosylated alpha subunit and a glycosylated beta subunit that is cleaved to the mature enzyme posttranslationally.

Poids moléculaire: 14 kDa (MW of target protein)