POLK anticorps
-
- Antigène Voir toutes POLK Anticorps
- POLK (Polymerase (DNA Directed) kappa (POLK))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp POLK est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- POLK antibody was raised using a synthetic peptide corresponding to a region with amino acids KINKIIMEATKGSRFYGNELKKEKQVNQRIENMMQQKAQITSQQLRKAQL
- Top Product
- Discover our top product POLK Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
POLK Blocking Peptide, catalog no. 33R-4442, is also available for use as a blocking control in assays to test for specificity of this POLK antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POLK antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- POLK (Polymerase (DNA Directed) kappa (POLK))
- Autre désignation
- POLK (POLK Produits)
- Synonymes
- anticorps DINB1, anticorps DINP, anticorps POLQ, anticorps Dinb1, anticorps POLK, anticorps si:ch211-254o18.3, anticorps DNA polymerase kappa, anticorps polymerase (DNA directed) kappa, anticorps polymerase (DNA directed), kappa, anticorps polymerase (DNA directed) kappa L homeolog, anticorps POLK, anticorps Polk, anticorps polk, anticorps Tb11.01.0080, anticorps Tb11.01.0010, anticorps Tb11.01.0020, anticorps Tb11.01.0030, anticorps Tb11.01.0040, anticorps Tb11.01.0050, anticorps Tb11.12.0001, anticorps Tb11.12.0002, anticorps Tb11.12.0003, anticorps polk.L, anticorps polk-1
- Sujet
- POLK belongs to the DNA polymerase type-Y family. It contains 2 Rad18-type zinc fingers and 1 umuC domain. POLK is a DNA polymerase specifically involved in DNA repair. It plays an important role in translesion synthesis, where the normal high-fidelity DNA polymerases cannot proceed and DNA synthesis stalls.
- Poids moléculaire
- 99 kDa (MW of target protein)
- Pathways
- Réparation de l'ADN
-