MCM2 anticorps (Middle Region)

N° du produit ABIN634144

Cet anticorps Lapin Polyclonal détecte spécifiquement MCM2 dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour MCM2 anticorps (Middle Region) (ABIN634144)

Antigène: MCM2 (Minichromosome Maintenance Complex Component 2 (MCM2))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MCM2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-MCM2 anticorps

Épitope: Middle Region

Specificité: MCM2 antibody was raised against the middle region of MCM2

Purification: Affinity purified

Immunogène: MCM2 antibody was raised using the middle region of MCM2 corresponding to a region with amino acids NNELLLFILKQLVAEQVTYQRNRFGAQQDTIEVPEKDLVDKARQINIHNL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MCM2 Blocking Peptide, (ABIN5614696), is also available for use as a blocking control in assays to test for specificity of this MCM2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MCM2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MCM2

Antigène: MCM2 (Minichromosome Maintenance Complex Component 2 (MCM2))

Autre désignation: MCM2

Sujet: This protein is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins.

Poids moléculaire: 102 kDa (MW of target protein)

Pathways: Réparation de l'ADN, Mitotic G1-G1/S Phases, DNA Replication, Chromatin Binding, Synthesis of DNA