MCM2 anticorps (Middle Region)

N° du produit ABIN634144

Détail du produit anti-MCM2 anticorps

Antigène: MCM2 (Minichromosome Maintenance Complex Component 2 (MCM2))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MCM2 est non-conjugé

Application: Western Blotting (WB)

Specificité: MCM2 antibody was raised against the middle region of MCM2

Purification: Affinity purified

Immunogène: MCM2 antibody was raised using the middle region of MCM2 corresponding to a region with amino acids NNELLLFILKQLVAEQVTYQRNRFGAQQDTIEVPEKDLVDKARQINIHNL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MCM2 Blocking Peptide, catalog no. 33R-6804, is also available for use as a blocking control in assays to test for specificity of this MCM2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MCM2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MCM2

Antigène: MCM2 (Minichromosome Maintenance Complex Component 2 (MCM2))

Autre désignation: MCM2 (MCM2 Produits)

Synonymes: anticorps CG7538, anticorps DmMCM2, anticorps DmMcm2, anticorps DmeMCM2, anticorps Dmel\\CG7538, anticorps MCM2, anticorps MCM2-7, anticorps MCM2_DROME, anticorps McM2, anticorps PCR3, anticorps dMCM2, anticorps l(3)rL074, anticorps XMcm2, anticorps bm28, anticorps ccnl1, anticorps cdc19, anticorps cdcl1, anticorps mitotin, anticorps cb737, anticorps chunp6905, anticorps BM28, anticorps CCNL1, anticorps CDCL1, anticorps D3S3194, anticorps MITOTIN, anticorps MCM7, anticorps AA959861, anticorps AW476101, anticorps Mcmd2, anticorps mKIAA0030, anticorps Minichromosome maintenance 2, anticorps minichromosome maintenance complex component 2, anticorps minichromosome maintenance complex component 2 L homeolog, anticorps Mcm2, anticorps mcm2, anticorps MCM2, anticorps mcm2.L

Sujet: This protein is one of the highly conserved mini-chromosome maintenance proteins (MCM) that are involved in the initiation of eukaryotic genome replication. The hexameric protein complex formed by MCM proteins is a key component of the pre-replication complex (pre_RC) and may be involved in the formation of replication forks and in the recruitment of other DNA replication related proteins.

Poids moléculaire: 102 kDa (MW of target protein)

Pathways: Réparation de l'ADN, Mitotic G1-G1/S Phases, DNA Replication, Chromatin Binding, Synthesis of DNA