MLH3 anticorps

N° du produit ABIN634149

Détail du produit anti-MLH3 anticorps

Antigène: MLH3 (MutL Homolog 3 (MLH3))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp MLH3 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: MLH3 antibody was raised using a synthetic peptide corresponding to a region with amino acids SMQVLQQVDNKFIACLMSTKTEENGEADSYEKQQAQGSGRKKLLSSTLIP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

MLH3 Blocking Peptide, catalog no. 33R-8644, is also available for use as a blocking control in assays to test for specificity of this MLH3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MLH3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur MLH3

Antigène: MLH3 (MutL Homolog 3 (MLH3))

Autre désignation: MLH3 (MLH3 Produits)

Synonymes: anticorps AV125803, anticorps BB126472, anticorps MGC80774, anticorps MLH3, anticorps HNPCC7, anticorps mutL homolog 3, anticorps mutL homolog 3 L homeolog, anticorps Mlh3, anticorps mlh3.L, anticorps MLH3, anticorps mlh3

Sujet: This gene is a member of the MutL-homolog (MLH) family of DNA mismatch repair (MMR) genes. MLH genes are implicated in maintaining genomic integrity during DNA replication and after meiotic recombination. MLH3 functions as a heterodimer with other family members. Somatic mutations in this gene frequently occur in tumors exhibiting microsatellite instability, and germline mutations have been linked to hereditary nonpolyposis colorectal cancer type 7 (HNPCC7). Several alternatively spliced transcript variants have been identified, but the full-length nature of only two transcript variants has been determined.

Poids moléculaire: 161 kDa (MW of target protein)

Pathways: Chromatin Binding