PSMD1 anticorps
-
- Antigène Voir toutes PSMD1 Anticorps
- PSMD1 (Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 1 (PSMD1))
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PSMD1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- PSMD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids DLYESASQQFLSSVIQNLRTVGTPIASVPGSTNTGTVPGSEKDSDSMETE
- Top Product
- Discover our top product PSMD1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PSMD1 Blocking Peptide, catalog no. 33R-2074, is also available for use as a blocking control in assays to test for specificity of this PSMD1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PSMD1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PSMD1 (Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 1 (PSMD1))
- Autre désignation
- PSMD1 (PSMD1 Produits)
- Synonymes
- anticorps P112, anticorps Rpn2, anticorps S1, anticorps 2410026J11Rik, anticorps zgc:55818, anticorps psmd1, anticorps proteasome 26S subunit, non-ATPase 1, anticorps proteasome (prosome, macropain) 26S subunit, non-ATPase, 1, anticorps proteasome 26S subunit, non-ATPase 1 L homeolog, anticorps PSMD1, anticorps Psmd1, anticorps psmd1, anticorps psmd1.L
- Sujet
- The 26S proteasome is a multicatalytic proteinase complex with a highly ordered structure composed of 2 complexes, a 20S core and a 19S regulator.
- Poids moléculaire
- 106 kDa (MW of target protein)
- Pathways
- Mitotic G1-G1/S Phases, DNA Replication, Synthesis of DNA, Ubiquitin Proteasome Pathway
-