NDN anticorps
-
- Antigène Voir toutes NDN Anticorps
- NDN (Necdin Homolog (Mouse) (NDN))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp NDN est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- NDN antibody was raised using a synthetic peptide corresponding to a region with amino acids VALSNRMPMTGLLLMILSLIYVKGRGARESAVWNVLRILGLRPWKKHSTF
- Top Product
- Discover our top product NDN Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
NDN Blocking Peptide, catalog no. 33R-9426, is also available for use as a blocking control in assays to test for specificity of this NDN antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDN antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- NDN (Necdin Homolog (Mouse) (NDN))
- Autre désignation
- NDN (NDN Produits)
- Synonymes
- anticorps LOC574323, anticorps AI528698, anticorps Peg6, anticorps NDN, anticorps HsT16328, anticorps PWCR, anticorps necdin, MAGE family member, anticorps necdin, anticorps NDN, anticorps Ndn
- Sujet
- This intronless gene is located in the Prader-Willi syndrome deletion region. It is an imprinted gene and is expressed exclusively from the paternal allele.
- Poids moléculaire
- 36 kDa (MW of target protein)
- Pathways
- Neurotrophin Signaling Pathway
-