NDN anticorps

N° du produit ABIN634231

Détail du produit anti-NDN anticorps

Antigène: NDN (Necdin Homolog (Mouse) (NDN))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NDN est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: NDN antibody was raised using a synthetic peptide corresponding to a region with amino acids VALSNRMPMTGLLLMILSLIYVKGRGARESAVWNVLRILGLRPWKKHSTF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NDN Blocking Peptide, catalog no. 33R-9426, is also available for use as a blocking control in assays to test for specificity of this NDN antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NDN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NDN

Antigène: NDN (Necdin Homolog (Mouse) (NDN))

Autre désignation: NDN (NDN Produits)

Synonymes: anticorps LOC574323, anticorps AI528698, anticorps Peg6, anticorps NDN, anticorps HsT16328, anticorps PWCR, anticorps necdin, MAGE family member, anticorps necdin, anticorps NDN, anticorps Ndn

Sujet: This intronless gene is located in the Prader-Willi syndrome deletion region. It is an imprinted gene and is expressed exclusively from the paternal allele.

Poids moléculaire: 36 kDa (MW of target protein)

Pathways: Neurotrophin Signaling Pathway