MSH2 anticorps
-
- Antigène Voir toutes MSH2 Anticorps
- MSH2 (Mismatch Repair Protein 2 (MSH2))
-
Reactivité
- Humain, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp MSH2 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- MSH2 antibody was raised using a synthetic peptide corresponding to a region with amino acids GNKASKENDWYLAYKASPGNLSQFEDILFGNNDMSASIGVVGVKMSAVDG
- Top Product
- Discover our top product MSH2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
MSH2 Blocking Peptide, catalog no. 33R-3449, is also available for use as a blocking control in assays to test for specificity of this MSH2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MSH2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- MSH2 (Mismatch Repair Protein 2 (MSH2))
- Autre désignation
- MSH2 (MSH2 Produits)
- Synonymes
- anticorps COCA1, anticorps FCC1, anticorps HNPCC, anticorps HNPCC1, anticorps LCFS2, anticorps AI788990, anticorps wu:fc06b02, anticorps wu:fc13e09, anticorps zgc:55333, anticorps ATMSH2, anticorps MUTS homolog 2, anticorps msh2, anticorps mutS homolog 2, anticorps mutS homolog 2 (E. coli), anticorps MUTS homolog 2, anticorps mutS homolog 2 L homeolog, anticorps MutS protein homolog 2, anticorps MSH2, anticorps Msh2, anticorps msh2, anticorps msh2.L
- Sujet
- MSH2 was identified as a locus frequently mutated in hereditary nonpolyposis colon cancer (HNPCC). When cloned, it was discovered to be a human homolog of the E. coli mismatch repair gene mutS, consistent with the characteristic alterations in microsatellite sequences (RER+ phenotype) found in HNPCC. MSH2 was identified as a locus frequently mutated in hereditary nonpolyposis colon cancer (HNPCC). When cloned, it was discovered to be a human homolog of the E. coli mismatch repair gene mutS, consistent with the characteristic alterations in microsatellite sequences (RER+ phenotype) found in HNPCC.
- Poids moléculaire
- 105 kDa (MW of target protein)
- Pathways
- Réparation de l'ADN, Production of Molecular Mediator of Immune Response
-