ECT2 anticorps (Middle Region)
-
- Antigène Voir toutes ECT2 Anticorps
- ECT2 (Epithelial Cell Transforming Sequence 2 Oncogene (ECT2))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ECT2 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ECT2 antibody was raised against the middle region of ECT2
- Purification
- Affinity purified
- Immunogène
- ECT2 antibody was raised using the middle region of ECT2 corresponding to a region with amino acids KKHTADENPDKSTLEKAIGSLKEVMTHINEDKRKTEAQKQIFDVVYEVDG
- Top Product
- Discover our top product ECT2 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ECT2 Blocking Peptide, catalog no. 33R-4471, is also available for use as a blocking control in assays to test for specificity of this ECT2 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ECT2 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ECT2 (Epithelial Cell Transforming Sequence 2 Oncogene (ECT2))
- Autre désignation
- ECT2 (ECT2 Produits)
- Synonymes
- anticorps ECT2, anticorps arhgef31, anticorps xect2, anticorps AI528536, anticorps mKIAA4037, anticorps ARHGEF31, anticorps ect2, anticorps epithelial cell transforming 2, anticorps ect2 oncogene, anticorps epithelial cell transforming 2 S homeolog, anticorps ECT2, anticorps ect2, anticorps Ect2, anticorps ect2.S
- Sujet
- ECT2 is a transforming protein that is related to Rho-specific exchange factors and yeast cell cycle regulators. The expression of ECT2 is elevated with the onset of DNA synthesis and remains elevated during G2 and M phases. In situ hybridization analysis showed that expression is at a high level in cells undergoing mitosis in regenerating liver. Thus, this protein is expressed in a cell cycle-dependent manner during liver regeneration, and is thought to have an important role in the regulation of cytokinesis.
- Poids moléculaire
- 100 kDa (MW of target protein)
- Pathways
- Neurotrophin Signaling Pathway, Cell-Cell Junction Organization
-