ARAF anticorps (Middle Region)

N° du produit ABIN634291

Cet anticorps Lapin Polyclonal détecte spécifiquement ARAF dans WB. Il présente une réactivité avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour ARAF anticorps (Middle Region) (ABIN634291)

Antigène: ARAF (V-Raf Murine Sarcoma 3611 Viral Oncogene Homolog (ARAF))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ARAF est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ARAF anticorps

Épitope: Middle Region

Specificité: ARAF antibody was raised against the middle region of ARAF

Purification: Affinity purified

Immunogène: ARAF antibody was raised using the middle region of ARAF corresponding to a region with amino acids PRGSPSPASVSSGRKSPHSKSPAEQRERKSLADDKKKVKNLGYRDSGYYW

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ARAF Blocking Peptide, (ABIN5612132), is also available for use as a blocking control in assays to test for specificity of this ARAF antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARAF antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ARAF

Antigène: ARAF (V-Raf Murine Sarcoma 3611 Viral Oncogene Homolog (ARAF))

Autre désignation: ARAF

Sujet: ARAF belongs to the protein kinase superfamily, TKL Ser/Thr protein kinase family, RAF subfamily. It contains 1 phorbol-ester/DAG-type zinc finger, 1 protein kinase domain, and 1 RBD (Ras-binding) domain. ARAF is involved in the transduction of mitogenic signals from the cell membrane to the nucleus.

Poids moléculaire: 67 kDa (MW of target protein)

Pathways: Signalisation MAPK, Signalisation RTK, Hepatitis C