ARAF anticorps (Middle Region)
-
- Antigène Voir toutes ARAF Anticorps
- ARAF (V-Raf Murine Sarcoma 3611 Viral Oncogene Homolog (ARAF))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp ARAF est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- ARAF antibody was raised against the middle region of ARAF
- Purification
- Affinity purified
- Immunogène
- ARAF antibody was raised using the middle region of ARAF corresponding to a region with amino acids PRGSPSPASVSSGRKSPHSKSPAEQRERKSLADDKKKVKNLGYRDSGYYW
- Top Product
- Discover our top product ARAF Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
ARAF Blocking Peptide, catalog no. 33R-7324, is also available for use as a blocking control in assays to test for specificity of this ARAF antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ARAF antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- ARAF (V-Raf Murine Sarcoma 3611 Viral Oncogene Homolog (ARAF))
- Autre désignation
- ARAF (ARAF Produits)
- Synonymes
- anticorps zgc:92074, anticorps wu:fk45h07, anticorps ARAF, anticorps a-raf, anticorps araf, anticorps araf1, anticorps pks2, anticorps rafa1, anticorps A-RAF, anticorps ARAF1, anticorps PKS2, anticorps RAFA1, anticorps 1200013E08Rik, anticorps A-Raf, anticorps AW495444, anticorps Araf1, anticorps A-Raf proto-oncogene, serine/threonine kinase, anticorps A-Raf proto-oncogene, serine/threonine kinase L homeolog, anticorps A-Raf proto-oncogene, serine/threonine kinase S homeolog, anticorps Araf proto-oncogene, serine/threonine kinase, anticorps araf, anticorps ARAF, anticorps araf.L, anticorps araf.S, anticorps Araf
- Sujet
- ARAF belongs to the protein kinase superfamily, TKL Ser/Thr protein kinase family, RAF subfamily. It contains 1 phorbol-ester/DAG-type zinc finger, 1 protein kinase domain, and 1 RBD (Ras-binding) domain. ARAF is involved in the transduction of mitogenic signals from the cell membrane to the nucleus.
- Poids moléculaire
- 67 kDa (MW of target protein)
- Pathways
- Signalisation MAPK, Signalisation RTK, Hepatitis C
-