RPS6KA2 anticorps (Middle Region)

N° du produit ABIN634332

Détail du produit anti-RPS6KA2 anticorps

Antigène: RPS6KA2 (Ribosomal Protein S6 Kinase, 90kDa, Polypeptide 2 (RPS6KA2))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RPS6KA2 est non-conjugé

Application: Western Blotting (WB)

Specificité: RPS6 KA2 antibody was raised against the middle region of RPS6 A2

Purification: Affinity purified

Immunogène: RPS6 KA2 antibody was raised using the middle region of RPS6 A2 corresponding to a region with amino acids LSRQDVHLVKGAMAATYFALNRTPQAPRLEPVLSSNLAQRRGMKRLTSTR

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RPS6KA2 Blocking Peptide, catalog no. 33R-5450, is also available for use as a blocking control in assays to test for specificity of this RPS6KA2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RPS0 A2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RPS6KA2

Antigène: RPS6KA2 (Ribosomal Protein S6 Kinase, 90kDa, Polypeptide 2 (RPS6KA2))

Autre désignation: RPS6KA2 (RPS6KA2 Produits)

Synonymes: anticorps HU-2, anticorps MAPKAPK1C, anticorps RSK, anticorps RSK3, anticorps S6K-alpha, anticorps S6K-alpha2, anticorps p90-RSK3, anticorps pp90RSK3, anticorps 90kDa, anticorps D17Wsu134e, anticorps Rps6ka-rs1, anticorps Rsk3, anticorps p90rsk, anticorps pp90rsk, anticorps ribosomal protein S6 kinase A2, anticorps ribosomal protein S6 kinase, polypeptide 2, anticorps Rps6ka2, anticorps RPS6KA2

Sujet: RPS6KA2 is a serine/threonine kinase that may play a role in mediating the growth-factor and stress induced activation of the transcription factor CREB.

Poids moléculaire: 81 kDa (MW of target protein)

Pathways: Signalisation MAPK, Neurotrophin Signaling Pathway, Regulation of Systemic Arterial Blood Pressure by Hormones, Activation of Innate immune Response, Toll-Like Receptors Cascades