PPM1A anticorps

N° du produit ABIN634361

Détail du produit anti-PPM1A anticorps

Antigène: PPM1A (Protein Phosphatase, Mg2+/Mn2+ Dependent, 1A (PPM1A))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PPM1A est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: PPM1 A antibody was raised using a synthetic peptide corresponding to a region with amino acids EIDEHMRVMSEKKHGADRSGSTAVGVLISPQHTYFINCGDSRGLLCRNRK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PPM1A Blocking Peptide, catalog no. 33R-2464, is also available for use as a blocking control in assays to test for specificity of this PPM1A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PPM0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PPM1A

Antigène: PPM1A (Protein Phosphatase, Mg2+/Mn2+ Dependent, 1A (PPM1A))

Autre désignation: PPM1A (PPM1A Produits)

Synonymes: anticorps PP2C-ALPHA, anticorps PP2CA, anticorps PP2Calpha, anticorps pp2ca1, anticorps ppp1r13b, anticorps si:ch211-253p18.1, anticorps wu:fd42g12, anticorps zgc:153820, anticorps 2310003C21Rik, anticorps 2900017D14Rik, anticorps AI427932, anticorps AU017636, anticorps MMPa-2, anticorps MPPa-1, anticorps Pp2c1, anticorps pp2c-alpha, anticorps pp2ca, anticorps pp2calpha, anticorps pp2ca2, anticorps protein phosphatase, Mg2+/Mn2+ dependent 1A, anticorps protein phosphatase, Mg2+/Mn2+ dependent, 1Ab, anticorps protein phosphatase 1A, magnesium dependent, alpha isoform, anticorps protein phosphatase, Mg2+/Mn2+ dependent, 1A, anticorps protein phosphatase, Mg2+/Mn2+ dependent 1A L homeolog, anticorps protein phosphatase, Mg2+/Mn2+ dependent, 1Aa, anticorps PPM1A, anticorps ppm1ab, anticorps Ppm1a, anticorps ppm1a.L, anticorps ppm1aa

Sujet: The protein encoded by this gene is a member of the PP2C family of Ser/Thr protein phosphatases. PP2C family members are known to be negative regulators of cell stress response pathways.

Poids moléculaire: 36 kDa (MW of target protein)