PKC gamma anticorps (Middle Region)

N° du produit ABIN634424

Détail du produit anti-PKC gamma anticorps

Antigène: PKC gamma (PRKCG) (Protein Kinase C, gamma (PRKCG))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PKC gamma est non-conjugé

Application: Western Blotting (WB)

Specificité: PRKCG antibody was raised against the middle region of PRKCG

Purification: Affinity purified

Immunogène: PRKCG antibody was raised using the middle region of PRKCG corresponding to a region with amino acids WSFGVLLYEMLAGQPPFDGEDEEELFQAIMEQTVTYPKSLSREAVAICKG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PRKCG Blocking Peptide, catalog no. 33R-10011, is also available for use as a blocking control in assays to test for specificity of this PRKCG antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRKCG antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PKC gamma

Antigène: PKC gamma (PRKCG) (Protein Kinase C, gamma (PRKCG))

Autre désignation: PRKCG (PRKCG Produits)

Synonymes: anticorps PRKCG, anticorps PKC-gamma, anticorps PKCC, anticorps PKCG, anticorps SCA14, anticorps PKCgamma, anticorps Pkcc, anticorps Prkcc, anticorps PKC, anticorps PKCI, anticorps Prkc, anticorps RATPKCI, anticorps protein kinase C gamma, anticorps protein kinase C, gamma, anticorps protein kinase C gamma type, anticorps PRKCG, anticorps Prkcg, anticorps LOC484316

Sujet: Protein kinase C (PKC) is a family of serine- and threonine-specific protein kinases that can be activated by calcium and second messenger diacylglycerol. PKC family members phosphorylate a wide variety of protein targets.

Poids moléculaire: 78 kDa (MW of target protein)

Pathways: Signalisation WNT, EGFR Signaling Pathway, Neurotrophin Signaling Pathway, Thyroid Hormone Synthesis, Myometrial Relaxation and Contraction, G-protein mediated Events, Positive Regulation of Response to DNA Damage Stimulus, Interaction of EGFR with phospholipase C-gamma, Thromboxane A2 Receptor Signaling, VEGF Signaling