G3BP1 anticorps
-
- Antigène Voir toutes G3BP1 Anticorps
- G3BP1 (GTPase Activating Protein (SH3 Domain) Binding Protein 1 (G3BP1))
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp G3BP1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- G3 BP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RFMQTFVLAPEGSVANKFYVHNDIFRYQDEVFGGFVTEPQEESEEEVEEP
- Top Product
- Discover our top product G3BP1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
G3BP1 Blocking Peptide, catalog no. 33R-7905, is also available for use as a blocking control in assays to test for specificity of this G3BP1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of G0 P1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- G3BP1 (GTPase Activating Protein (SH3 Domain) Binding Protein 1 (G3BP1))
- Autre désignation
- G3BP1 (G3BP1 Produits)
- Synonymes
- anticorps G3BP, anticorps HDH-VIII, anticorps fj17h05, anticorps zgc:56034, anticorps wu:fj17h05, anticorps g3bp, anticorps MGC53271, anticorps G3BP1, anticorps G3bp, anticorps RGD1310666, anticorps AI849976, anticorps B430204O07, anticorps C87777, anticorps mKIAA4115, anticorps G3BP stress granule assembly factor 1, anticorps GTPase activating protein (SH3 domain) binding protein 1, anticorps GTPase activating protein (SH3 domain) binding protein 1 L homeolog, anticorps Ras-GTPase-activating protein SH3-domain-binding protein, anticorps G3BP1, anticorps g3bp1, anticorps g3bp1.L, anticorps LOC100304885, anticorps G3bp1
- Sujet
- This gene encodes one of the DNA-unwinding enzymes which prefers partially unwound 3'-tailed substrates and can also unwind partial RNA/DNA and RNA/RNA duplexes in an ATP-dependent fashion.
- Poids moléculaire
- 52 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interactome
-